KEGG   Homo sapiens (human): 145873Help
Entry
145873            CDS       T01001                                 

Gene name
MESP2, SCDO2, bHLHc6
Definition
mesoderm posterior 2 homolog (mouse)
Orthology
K09076  
mesoderm posterior
Organism
hsa  Homo sapiens (human)
Disease
H00517  
Spondylocostal dysostosis (SCD)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Mesp
    145873 (MESP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
15q26.1
AA seq 397 aa AA seqDB search
MAQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCS
SRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLT
KIETLRLAIRYIGHLSAVLGLSEESLQCRRRQRGDAGSPWGCPLCPDRGPAEAQTQAEGQ
GQGQGQGQGQGQGQGQGQGQGQGQGRRPGLVSAVLAEASWGSPSACPGAQAAPERLGRGV
HDTDPWATPPYCPKIQSPPYSSQGTTSDASLWTPPQGCPWTQSSPEPRNPPVPWTAAPAT
LELAAVYQGLSVSPEPCLSLGAPSLLPHPSCQRLQPQTPGRCWSHSAEVVPNSEDQGPGA
AFQLSEASPPQSSGLRFSGCPELWQEDLEGARLGIFY
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtcgcctcctccgcagagcctcctcggccacgaccactggatcttcgcccag
ggctggggctgggccggccactgggactccacgtccccggcctcctcctccgattcgtcg
ggttcgtgcccctgcgacggcgcccgcggactcccgcagccacagcctccgagctgcagc
tcccgagccgcagaggcagccgcgacgacgcccagacgagcgcgcaccggaccagcgggc
ggacagcggcagagcgccagcgagcgggagaaactgcgcatgcgcacgctggcccgcgcc
ctgcacgagttgcgccgctttctgcctccctccttggcgccggccggccagagcctgacc
aagatcgagacgctgcgcctggccatccgctacatcggccacctatcggccgtgctgggt
ctcagcgaggagagtctgcagtgccggcgcaggcagcgcggggacgcggggtccccttgg
ggctgcccgctgtgccccgaccgtggccccgcagaggcgcagacgcaggcggaggggcag
gggcaagggcaggggcaggggcaggggcaagggcaggggcaaggacaggggcaaggacag
gggcaagggcaggggcgcaggccgggcctggtctccgccgtcctcgccgaggcgtcctgg
ggatccccgtccgcctgccccggagcccaagccgcacccgagcgcctggggaggggggtc
cacgacacggatccctgggcaacacccccttactgccccaagatacagtcgcccccgtat
tcgtcccaagggacaacctccgacgcgtctctttggacgccaccccaaggctgtccctgg
acgcagtcgtccccagagccccggaacccaccagtgccctggacggcggccccagcaact
ttggagctggccgcagtgtaccagggtctctctgtgtctccagagccctgtctgtcgctg
ggagctccatctctcctgccccacccatcatgccagagactgcagcctcagacccccggg
aggtgctggagccacagtgcagaggtggtgcccaactcagaggaccagggaccgggcgcc
gccttccagctcagtgaagcaagccctccccagagctcaggcctgcggttcagtggctgc
cctgaactttggcaagaagatctggagggggcccgcctgggcatcttctactaa

DBGET integrated database retrieval system