KEGG   Homo sapiens (human): 1459Help
Entry
1459              CDS       T01001                                 

Gene name
CSNK2A2, CK2A2, CSNK2A1
Definition
casein kinase 2, alpha prime polypeptide (EC:2.7.11.1)
Orthology
K03097  
casein kinase II subunit alpha [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
NF-kappa B signaling pathway
Wnt signaling pathway
Adherens junction
Tight junction
Measles
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    1459 (CSNK2A2)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    1459 (CSNK2A2)
   04064 NF-kappa B signaling pathway
    1459 (CSNK2A2)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    1459 (CSNK2A2)
   04530 Tight junction
    1459 (CSNK2A2)
 Human Diseases
  Infectious diseases
   05162 Measles
    1459 (CSNK2A2)
   05168 Herpes simplex infection
    1459 (CSNK2A2)
   05169 Epstein-Barr virus infection
    1459 (CSNK2A2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1459 (CSNK2A2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  CK2 family
   1459 (CSNK2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q21
AA seq 350 aa AA seqDB search
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINI
TNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNT
DFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLA
EFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNY
DQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcccggccgcgggcagcagggcccgggtctacgccgaggtgaacagtctgagg
agccgcgagtactgggactacgaggctcacgtcccgagctggggtaatcaagatgattac
caactggttcgaaaacttggtcggggaaaatatagtgaagtatttgaggccattaatatc
accaacaatgagagagtggttgtaaaaatcctgaagccagtgaagaaaaagaagataaaa
cgagaggttaagattctggagaaccttcgtggtggaacaaatatcattaagctgattgac
actgtaaaggaccccgtgtcaaagacaccagctttggtatttgaatatatcaataataca
gattttaagcaactctaccagatcctgacagactttgatatccggttttatatgtatgaa
ctacttaaagctctggattactgccacagcaagggaatcatgcacagggatgtgaaacct
cacaatgtcatgatagatcaccaacagaaaaagctgcgactgatagattggggtctggca
gaattctatcatcctgctcaggagtacaatgttcgtgtagcctcaaggtacttcaaggga
ccagagctcctcgtggactatcagatgtatgattatagcttggacatgtggagtttgggc
tgtatgttagcaagcatgatctttcgaagggaaccattcttccatggacaggacaactat
gaccagcttgttcgcattgccaaggttctgggtacagaagaactgtatgggtatctgaag
aagtatcacatagacctagatccacacttcaacgatatcctgggacaacattcacggaaa
cgctgggaaaactttatccatagtgagaacagacaccttgtcagccctgaggccctagat
cttctggacaaacttctgcgatacgaccatcaacagagactgactgccaaagaggccatg
gagcacccatacttctaccctgtggtgaaggagcagtcccagccttgtgcagacaatgct
gtgctttccagtggtctcacggcagcacgatga

DBGET integrated database retrieval system