KEGG   Homo sapiens (human): 1459Help
Entry
1459              CDS       T01001                                 

Gene name
CSNK2A2, CK2A2, CK2alpha', CSNK2A1
Definition
(RefSeq) casein kinase 2 alpha 2
  KO
K03097  
casein kinase II subunit alpha [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
NF-kappa B signaling pathway
Wnt signaling pathway
Adherens junction
Tight junction
Measles
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    1459 (CSNK2A2)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    1459 (CSNK2A2)
   04064 NF-kappa B signaling pathway
    1459 (CSNK2A2)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    1459 (CSNK2A2)
   04530 Tight junction
    1459 (CSNK2A2)
 Human Diseases
  Infectious diseases
   05162 Measles
    1459 (CSNK2A2)
   05168 Herpes simplex infection
    1459 (CSNK2A2)
   05169 Epstein-Barr virus infection
    1459 (CSNK2A2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1459 (CSNK2A2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  CK2 family
   1459 (CSNK2A2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   Kinase
    1459 (CSNK2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q21
AA seq 350 aa AA seqDB search
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINI
TNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNT
DFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLA
EFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNY
DQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcccggccgcgggcagcagggcccgggtctacgccgaggtgaacagtctgagg
agccgcgagtactgggactacgaggctcacgtcccgagctggggtaatcaagatgattac
caactggttcgaaaacttggtcggggaaaatatagtgaagtatttgaggccattaatatc
accaacaatgagagagtggttgtaaaaatcctgaagccagtgaagaaaaagaagataaaa
cgagaggttaagattctggagaaccttcgtggtggaacaaatatcattaagctgattgac
actgtaaaggaccccgtgtcaaagacaccagctttggtatttgaatatatcaataataca
gattttaagcaactctaccagatcctgacagactttgatatccggttttatatgtatgaa
ctacttaaagctctggattactgccacagcaagggaatcatgcacagggatgtgaaacct
cacaatgtcatgatagatcaccaacagaaaaagctgcgactgatagattggggtctggca
gaattctatcatcctgctcaggagtacaatgttcgtgtagcctcaaggtacttcaaggga
ccagagctcctcgtggactatcagatgtatgattatagcttggacatgtggagtttgggc
tgtatgttagcaagcatgatctttcgaagggaaccattcttccatggacaggacaactat
gaccagcttgttcgcattgccaaggttctgggtacagaagaactgtatgggtatctgaag
aagtatcacatagacctagatccacacttcaacgatatcctgggacaacattcacggaaa
cgctgggaaaactttatccatagtgagaacagacaccttgtcagccctgaggccctagat
cttctggacaaacttctgcgatacgaccatcaacagagactgactgccaaagaggccatg
gagcacccatacttctaccctgtggtgaaggagcagtcccagccttgtgcagacaatgct
gtgctttccagtggtctcacggcagcacgatga

DBGET integrated database retrieval system