KEGG   Homo sapiens (human): 146Help
Entry
146               CDS       T01001                                 

Gene name
ADRA1D, ADRA1, ADRA1A, ADRA1R, ALPHA1, DAR, dJ779E11.2
Definition
(RefSeq) adrenoceptor alpha 1D
  KO
K04137  
adrenergic receptor alpha-1D
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Salivary secretion
Drug target
Epinephrine [DG:DG00013]: 
Adrenalone [DG:DG00016]: 
Amiodarone [DG:DG00204]: 
Dronedarone [DG:DG00207]: 
Etilefrine [DG:DG00210]: 
Norepinephrine [DG:DG00212]: 
Norfenefrine [DG:DG00214]: 
Phenylephrine [DG:DG00215]: 
Oxedrine [DG:DG00217]: 
Metaraminol [DG:DG00218]: 
Methoxamine [DG:DG00219]: 
Midodrine [DG:DG00224]: 
Arbutamine: 
Ephedrine [DG:DG00227]: 
Prazosin [DG:DG00253]: 
Indoramin [DG:DG00254]: 
Trimazosin [DG:DG00255]: 
Doxazosin [DG:DG00256]: 
Urapidil [DG:DG00257]: 
Ketanserin [DG:DG00265]: 
Phentolamine [DG:DG00280]: 
Tolazoline [DG:DG00281]: 
Nicergoline [DG:DG00283]: 
Phenoxybenzamine [DG:DG00285]: 
Moxisylyte [DG:DG00287]: 
Ifenprodil [DG:DG00292]: 
Labetalol [DG:DG00320]: 
Carvedilol [DG:DG00321]: 
Methylergometrine [DG:DG00445]: 
Ergot alkaloids: 
Ergometrine [DG:DG00446]: 
Alfuzosin [DG:DG00489]: 
Tamsulosin [DG:DG00490]: 
Terazosin [DG:DG00491]: 
Silodosin: 
Dihydroergotamine [DG:DG00833]: 
Ergotamine [DG:DG00834]: 
Levomepromazine [DG:DG00868]: 
Sertindole: 
Pimozide: 
Clozapine: 
Olanzapine [DG:DG00898]: 
Quetiapine [DG:DG00899]: 
Asenapine: 
Risperidone: 
Mianserin [DG:DG00951]: 
Oxymetazoline [DG:DG01029]: 
Tetryzoline [DG:DG01030]: 
Xylometazoline [DG:DG01031]: 
Naphazoline [DG:DG01032]: 
Tramazoline [DG:DG01033]: 
Pseudoephedrine [DG:DG01042]: 
Dipivefrine [DG:DG01129]: 
Levobunolol [DG:DG01136]: 
Dapiprazole [DG:DG01140]: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    146 (ADRA1D)
   04022 cGMP - PKG signaling pathway
    146 (ADRA1D)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    146 (ADRA1D)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    146 (ADRA1D)
   04270 Vascular smooth muscle contraction
    146 (ADRA1D)
  Digestive system
   04970 Salivary secretion
    146 (ADRA1D)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    146 (ADRA1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p13
AA seq 572 aa AA seqDB search
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
AVSLGVPHEVAEGATCQAYELADYSNLRETDI
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgactttccgcgatctcctgagcgtcagtttcgagggaccccgcccggacagcagcgca
gggggctccagcgcgggcggcggcgggggcagcgcgggcggcgcggccccctcggagggc
ccggcggtgggcggcgtgccggggggcgcgggcggcggcggcggcgtggtgggcgcaggc
agcggcgaggacaaccggagctccgcgggggagccggggagcgcgggcgcgggcggcgac
gtgaatggcacggcggccgtcgggggactggtggtgagcgcgcagggcgtgggcgtgggc
gtcttcctggcagccttcatccttatggccgtggcaggtaacctgcttgtcatcctctca
gtggcctgcaaccgccacctgcagaccgtcaccaactatttcatcgtgaacctggccgtg
gccgacctgctgctgagcgccaccgtactgcccttctcggccaccatggaggttctgggc
ttctgggcctttggccgcgccttctgcgacgtatgggccgccgtggacgtgctgtgctgc
acggcctccatcctcagcctctgcaccatctccgtggaccggtacgtgggcgtgcgccac
tcactcaagtacccagccatcatgaccgagcgcaaggcggccgccatcctggccctgctc
tgggtcgtagccctggtggtgtccgtagggcccctgctgggctggaaggagcccgtgccc
cctgacgagcgcttctgcggtatcaccgaggaggcgggctacgctgtcttctcctccgtg
tgctccttctacctgcccatggcggtcatcgtggtcatgtactgccgcgtgtacgtggtc
gcgcgcagcaccacgcgcagcctcgaggcgggcgtcaagcgcgagcgaggcaaggcctcc
gaggtggtgctgcgcatccactgtcgcggcgcggccacgggcgccgacggggcgcacggc
atgcgcagcgccaagggccacaccttccgcagctcgctctccgtgcgcctgctcaagttc
tcccgtgagaagaaagcggccaagactctggccatcgtcgtgggtgtcttcgtgctctgc
tggttccctttcttctttgtcctgccgctcggctccttgttcccgcagctgaagccatcg
gagggcgtcttcaaggtcatcttctggctcggctacttcaacagctgcgtgaacccgctc
atctacccctgttccagccgcgagttcaagcgcgccttcctccgtctcctgcgctgccag
tgccgtcgtcgccggcgccgccgccctctctggcgtgtctacggccaccactggcgggcc
tccaccagcggcctgcgccaggactgcgccccgagttcgggcgacgcgccccccggagcg
ccgctggccctcaccgcgctccccgaccccgaccccgaacccccaggcacgcccgagatg
caggctccggtcgccagccgtcgaaagccacccagcgccttccgcgagtggaggctgctg
gggccgttccggagacccacgacccagctgcgcgccaaagtctccagcctgtcgcacaag
atccgcgccgggggcgcgcagcgcgcagaggcagcgtgcgcccagcgctcagaggtggag
gctgtgtccctaggcgtcccacacgaggtggccgagggcgccacctgccaggcctacgaa
ttggccgactacagcaacctacgggagaccgatatttaa

DBGET integrated database retrieval system