KEGG   Homo sapiens (human): 146Help
Entry
146               CDS       T01001                                 

Gene name
ADRA1D, ADRA1, ADRA1A, ADRA1R, ALPHA1, DAR, dJ779E11.2
Definition
adrenoceptor alpha 1D
Orthology
K04137  
adrenergic receptor alpha-1D
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Salivary secretion
Drug target
Epinephrine: 
Amiodarone: 
Dronedarone: 
Etilefrine: 
Norepinephrine: 
Norfenefrine: 
Phenylephrine: 
Oxedrine: 
Metaraminol: 
Methoxamine: 
Midodrine: 
Arbutamine: 
Ephedrine: 
Prazosin: 
Indoramin: 
Trimazosin: 
Doxazosin: 
Urapidil: 
Ketanserin: 
Phentolamine: 
Tolazoline: 
Nicergoline: 
Phenoxybenzamine: 
Moxisylyte: 
Ifenprodil: 
Labetalol: 
Carvedilol: 
Methylergometrine: 
Ergot alkaloids: 
Ergometrine: 
Alfuzosin: 
Tamsulosin: 
Terazosin: 
Silodosin: 
Dihydroergotamine: 
Ergotamine: 
Levomepromazine: 
Sertindole: 
Pimozide: 
Clozapine: 
Olanzapine: 
Quetiapine: 
Asenapine: 
Risperidone: 
Mianserin: 
Oxymetazoline: 
Tetryzoline: 
Xylometazoline: 
Naphazoline: 
Tramazoline: 
Pseudoephedrine: 
Dipivefrine: 
Levobunolol: 
Dapiprazole: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p13
AA seq 572 aa AA seqDB search
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
AVSLGVPHEVAEGATCQAYELADYSNLRETDI
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgactttccgcgatctcctgagcgtcagtttcgagggaccccgcccggacagcagcgca
gggggctccagcgcgggcggcggcgggggcagcgcgggcggcgcggccccctcggagggc
ccggcggtgggcggcgtgccggggggcgcgggcggcggcggcggcgtggtgggcgcaggc
agcggcgaggacaaccggagctccgcgggggagccggggagcgcgggcgcgggcggcgac
gtgaatggcacggcggccgtcgggggactggtggtgagcgcgcagggcgtgggcgtgggc
gtcttcctggcagccttcatccttatggccgtggcaggtaacctgcttgtcatcctctca
gtggcctgcaaccgccacctgcagaccgtcaccaactatttcatcgtgaacctggccgtg
gccgacctgctgctgagcgccaccgtactgcccttctcggccaccatggaggttctgggc
ttctgggcctttggccgcgccttctgcgacgtatgggccgccgtggacgtgctgtgctgc
acggcctccatcctcagcctctgcaccatctccgtggaccggtacgtgggcgtgcgccac
tcactcaagtacccagccatcatgaccgagcgcaaggcggccgccatcctggccctgctc
tgggtcgtagccctggtggtgtccgtagggcccctgctgggctggaaggagcccgtgccc
cctgacgagcgcttctgcggtatcaccgaggaggcgggctacgctgtcttctcctccgtg
tgctccttctacctgcccatggcggtcatcgtggtcatgtactgccgcgtgtacgtggtc
gcgcgcagcaccacgcgcagcctcgaggcgggcgtcaagcgcgagcgaggcaaggcctcc
gaggtggtgctgcgcatccactgtcgcggcgcggccacgggcgccgacggggcgcacggc
atgcgcagcgccaagggccacaccttccgcagctcgctctccgtgcgcctgctcaagttc
tcccgtgagaagaaagcggccaagactctggccatcgtcgtgggtgtcttcgtgctctgc
tggttccctttcttctttgtcctgccgctcggctccttgttcccgcagctgaagccatcg
gagggcgtcttcaaggtcatcttctggctcggctacttcaacagctgcgtgaacccgctc
atctacccctgttccagccgcgagttcaagcgcgccttcctccgtctcctgcgctgccag
tgccgtcgtcgccggcgccgccgccctctctggcgtgtctacggccaccactggcgggcc
tccaccagcggcctgcgccaggactgcgccccgagttcgggcgacgcgccccccggagcg
ccgctggccctcaccgcgctccccgaccccgaccccgaacccccaggcacgcccgagatg
caggctccggtcgccagccgtcgaaagccacccagcgccttccgcgagtggaggctgctg
gggccgttccggagacccacgacccagctgcgcgccaaagtctccagcctgtcgcacaag
atccgcgccgggggcgcgcagcgcgcagaggcagcgtgcgcccagcgctcagaggtggag
gctgtgtccctaggcgtcccacacgaggtggccgagggcgccacctgccaggcctacgaa
ttggccgactacagcaacctacgggagaccgatatttaa

DBGET integrated database retrieval system