KEGG   Homo sapiens (human): 1460Help
Entry
1460              CDS       T01001                                 

Gene name
CSNK2B, CK2B, CK2N, CSK2B, G5A
Definition
(RefSeq) casein kinase 2, beta polypeptide (EC:2.7.11.1)
  KO
K03115  
casein kinase II subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
NF-kappa B signaling pathway
Wnt signaling pathway
Adherens junction
Tight junction
Measles
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    1460 (CSNK2B)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    1460 (CSNK2B)
   04064 NF-kappa B signaling pathway
    1460 (CSNK2B)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    1460 (CSNK2B)
   04530 Tight junction
    1460 (CSNK2B)
 Human Diseases
  Infectious diseases
   05162 Measles
    1460 (CSNK2B)
   05168 Herpes simplex infection
    1460 (CSNK2B)
   05169 Epstein-Barr virus infection
    1460 (CSNK2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 212 aa AA seqDB search
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQF
VPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa
ttcttctgtgaagtggatgaagactacatccaggacaaatttaatcttactggactcaat
gagcaggtccctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa
gaactggaagacaaccccaaccagagtgacctgattgagcaggcagccgagatgctttat
ggattgatccacgcccgctacatccttaccaaccgtggcatcgcccagatgttggaaaag
taccagcaaggagactttggttactgtcctcgtgtgtactgtgagaaccagccaatgctt
cccattgacatcccaggtgaagccatggtgaagctctactgccccaagtgcatggatgtg
tacacacccaagtcatcaagacaccatcacacggatggcgcctacttcggcactggtttc
cctcacatgctcttcatggtgcatcccgagtaccggcccaagagacctgccaaccagttt
gtgcccaggctctacggtttcaagatccatccgatggcctaccagctgcagctccaagcc
gccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system