KEGG   Homo sapiens (human): 1460Help
Entry
1460              CDS       T01001                                 

Gene name
CSNK2B, CK2B, CK2N, CSK2B, G5A
Definition
casein kinase 2, beta polypeptide (EC:2.7.11.1)
Orthology
K03115  
casein kinase II subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
NF-kappa B signaling pathway
Wnt signaling pathway
Adherens junction
Tight junction
Measles
Herpes simplex infection
Epstein-Barr virus infection
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:hsa03008]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 212 aa AA seqDB search
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQF
VPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa
ttcttctgtgaagtggatgaagactacatccaggacaaatttaatcttactggactcaat
gagcaggtccctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa
gaactggaagacaaccccaaccagagtgacctgattgagcaggcagccgagatgctttat
ggattgatccacgcccgctacatccttaccaaccgtggcatcgcccagatgttggaaaag
taccagcaaggagactttggttactgtcctcgtgtgtactgtgagaaccagccaatgctt
cccattgacatcccaggtgaagccatggtgaagctctactgccccaagtgcatggatgtg
tacacacccaagtcatcaagacaccatcacacggatggcgcctacttcggcactggtttc
cctcacatgctcttcatggtgcatcccgagtaccggcccaagagacctgccaaccagttt
gtgcccaggctctacggtttcaagatccatccgatggcctaccagctgcagctccaagcc
gccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system