KEGG   Homo sapiens (human): 1460Help
Entry
1460              CDS       T01001                                 

Gene name
CSNK2B, CK2B, CK2N, CSK2B, Ckb1, Ckb2, G5A
Definition
(RefSeq) casein kinase 2 beta
  KO
K03115  
casein kinase II subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
NF-kappa B signaling pathway
Mitophagy - animal
Wnt signaling pathway
Adherens junction
Measles
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    1460 (CSNK2B)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    1460 (CSNK2B)
   04064 NF-kappa B signaling pathway
    1460 (CSNK2B)
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    1460 (CSNK2B)
  Cellular community - eukaryotes
   04520 Adherens junction
    1460 (CSNK2B)
 Human Diseases
  Infectious diseases
   05162 Measles
    1460 (CSNK2B)
   05168 Herpes simplex infection
    1460 (CSNK2B)
   05169 Epstein-Barr virus infection
    1460 (CSNK2B)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   Kinase
    1460 (CSNK2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P67870(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.33
AA seq 215 aa AA seqDB search
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa
ttcttctgtgaagtggatgaagactacatccaggacaaatttaatcttactggactcaat
gagcaggtccctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa
gaactggaagacaaccccaaccagagtgacctgattgagcaggcagccgagatgctttat
ggattgatccacgcccgctacatccttaccaaccgtggcatcgcccagatgttggaaaag
taccagcaaggagactttggttactgtcctcgtgtgtactgtgagaaccagccaatgctt
cccattggcctttcagacatcccaggtgaagccatggtgaagctctactgccccaagtgc
atggatgtgtacacacccaagtcatcaagacaccatcacacggatggcgcctacttcggc
actggtttccctcacatgctcttcatggtgcatcccgagtaccggcccaagagacctgcc
aaccagtttgtgcccaggctctacggtttcaagatccatccgatggcctaccagctgcag
ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system