KEGG   Homo sapiens (human): 147Help
Entry
147               CDS       T01001                                 

Gene name
ADRA1B, ADRA1, ALPHA1BAR
Definition
adrenoceptor alpha 1B
Orthology
K04136  
adrenergic receptor alpha-1B
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Salivary secretion
Drug target
Epinephrine: 
Adrenalone: 
Amiodarone: 
Dronedarone: 
Etilefrine: 
Norepinephrine: 
Norfenefrine: 
Phenylephrine: 
Oxedrine: 
Metaraminol: 
Methoxamine: 
Midodrine: 
Arbutamine: 
Ephedrine: 
Prazosin: 
Indoramin: 
Trimazosin: 
Doxazosin: 
Urapidil: 
Ketanserin: 
Phentolamine: 
Tolazoline: 
Nicergoline: 
Phenoxybenzamine: 
Moxisylyte: 
Ifenprodil: 
Labetalol: 
Carvedilol: 
Methylergometrine: 
Ergot alkaloids: 
Ergometrine: 
Alfuzosin: 
Tamsulosin: 
Terazosin: 
Silodosin: 
Dihydroergotamine: 
Ergotamine: 
Levomepromazine: 
Sertindole: 
Pimozide: 
Clozapine: 
Olanzapine: 
Quetiapine: 
Asenapine: 
Risperidone: 
Mianserin: 
Oxymetazoline: 
Tetryzoline: 
Xylometazoline: 
Naphazoline: 
Tramazoline: 
Pseudoephedrine: 
Dipivefrine: 
Levobunolol: 
Dapiprazole: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    147 (ADRA1B)
   04022 cGMP - PKG signaling pathway
    147 (ADRA1B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    147 (ADRA1B)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    147 (ADRA1B)
   04270 Vascular smooth muscle contraction
    147 (ADRA1B)
  Digestive system
   04970 Salivary secretion
    147 (ADRA1B)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    147 (ADRA1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
5q33.3
AA seq 520 aa AA seqDB search
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccgacctggacaccggccacaacacatcagcacctgcccactggggagagttg
aaaaatgccaacttcactggccccaaccagacctcgagcaactccacactgccccagctg
gacatcaccagggccatctctgtgggcctggtgctgggcgccttcatcctctttgccatc
gtgggcaacatcctagtcatcttgtctgtggcctgcaaccggcacctgcggacgcccacc
aactacttcattgtcaacctggccatggccgacctgctgttgagcttcaccgtcctgccc
ttctcagcggccctagaggtgctcggctactgggtgctggggcggatcttctgtgacatc
tgggcagccgtggatgtcctgtgctgcacagcgtccattctgagcctgtgcgccatctcc
atcgatcgctacatcggggtgcgctactctctgcagtatcccacgctggtcacccggagg
aaggccatcttggcgctgctcagtgtctgggtcttgtccaccgtcatctccatcgggcct
ctccttgggtggaaggagccggcacccaacgatgacaaggagtgcggggtcaccgaagaa
cccttctatgccctcttctcctctctgggctccttctacatccctctggcggtcattcta
gtcatgtactgccgtgtctatatagtggccaagagaaccaccaagaacctagaggcagga
gtcatgaaggagatgtccaactccaaggagctgaccctgaggatccattccaagaacttt
cacgaggacacccttagcagtaccaaggccaagggccacaaccccaggagttccatagct
gtcaaactttttaagttctccagggaaaagaaagcagctaagacgttgggcattgtggtc
ggtatgttcatcttgtgctggctacccttcttcatcgctctaccgcttggctccttgttc
tccaccctgaagccccccgacgccgtgttcaaggtggtgttctggctgggctacttcaac
agctgcctcaaccccatcatctacccatgctccagcaaggagttcaagcgcgctttcgtg
cgcatcctcgggtgccagtgccgcggccgcggccgccgccgacgccgccgccgccgtcgc
ctgggcggctgcgcctacacctaccggccgtggacgcgcggcggctcgctggagcgctcg
cagtcgcgcaaggactcgctggacgacagcggcagctgcctgagcggcagccagcggacc
ctgccctcggcctcgccgagcccgggctacctgggccgcggcgcgccaccgccagtcgag
ctgtgcgccttccccgagtggaaggcgcccggcgccctcctgagcctgcccgcgcctgag
ccccccggccgccgcggccgccacgactcgggcccgctcttcaccttcaagctcctgacc
gagcccgagagccccgggaccgacggcggcgccagcaacggaggctgcgaggccgcggcc
gacgtggccaacgggcagccgggcttcaaaagcaacatgcccctggcgcccgggcagttt
tag

DBGET integrated database retrieval system