KEGG   Homo sapiens (human): 148Help
Entry
148               CDS       T01001                                 

Gene name
ADRA1A, ADRA1C, ADRA1L1, ALPHA1AAR
Definition
(RefSeq) adrenoceptor alpha 1A
  KO
K04135  
adrenergic receptor alpha-1A
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Salivary secretion
Drug target
Adrenalone (DG00016): 
Alfuzosin (DG00489): 
Amidephrine mesylate: 
Amiodarone (DG00204): 
Amosulalol (DG01302): 
Arotinolol (DG01303): 
Asenapine: 
Bunazosin (DG01316): 
Bunitrolol hydrochloride: 
Carvedilol (DG00321): 
Clozapine: 
Dabuzalgron hydrochloride: 
Dapiprazole (DG01140): 
Dihydroergocristine (DG00284): 
Dihydroergotamine (DG00833): 
Dipivefrine (DG01129): 
Doxazosin (DG00256): 
Dronedarone (DG00207): 
Ephedrine (DG00227): 
Epinephrine (DG00013): 
Ergometrine (DG00446): 
Ergot alkaloids: 
Ergotamine (DG00834): 
Etilefrine (DG00210): 
Fiduxosin hydrochloride: 
Garomefrine hydrochloride: 
Guanadrel: 
Guanadrel sulfate: 
Ifenprodil (DG00292): 
Indoramin (DG00254): 
Ketanserin (DG00265): 
Labetalol (DG00320): 
Levobunolol (DG01136): 
Levomepromazine (DG00868): 
Medroxalol (DG01317): 
Metaraminol (DG00218): 
Methoxamine (DG00219): 
Methylephedrine (DG01229): 
Methylergometrine (DG00445): 
Mianserin (DG00951): 
Midodrine (DG00224): 
Moxisylyte (DG00287): 
Naftopidil: 
Naphazoline (DG01032): 
Nicergoline (DG00283): 
Nipradilol: 
Norepinephrine (DG00212): 
Norfenefrine (DG00214): 
Olanzapine (DG00898): 
Oxedrine (DG00217): 
Oxymetazoline (DG01029): 
Pelanserin hydrochloride: 
Phenoxybenzamine (DG00285): 
Phentolamine (DG00280): 
Phenylephrine (DG00215): 
Pimozide: 
Prazosin (DG00253): 
Pseudoephedrine (DG01042): 
Quetiapine (DG00899): 
Risperidone: 
Sertindole: 
Setiptiline (DG01231): 
Silodosin: 
Tamsulosin (DG00490): 
Terazosin (DG00491): 
Tetryzoline (DG01030): 
Tolazoline (DG00281): 
Tramazoline (DG01033): 
Trimazosin (DG00255): 
Urapidil (DG00257): 
Xylometazoline (DG01031): 
Yohimbin (DG00485): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    148 (ADRA1A)
   04022 cGMP - PKG signaling pathway
    148 (ADRA1A)
   04152 AMPK signaling pathway
    148 (ADRA1A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    148 (ADRA1A)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    148 (ADRA1A)
   04270 Vascular smooth muscle contraction
    148 (ADRA1A)
  Digestive system
   04970 Salivary secretion
    148 (ADRA1A)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    148 (ADRA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p21.2
AA seq 466 aa AA seqDB search
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctctcgggaaatgcttccgacagctccaactgcacccaaccgccggcaccg
gtgaacatttccaaggccattctgctcggggtgatcttggggggcctcattcttttcggg
gtgctgggtaacatcctagtgatcctctccgtagcctgtcaccgacacctgcactcagtc
acgcactactacatcgtcaacctggcggtggccgacctcctgctcacctccacggtgctg
cccttctccgccatcttcgaggtcctaggctactgggccttcggcagggtcttctgcaac
atctgggcggcagtggatgtgctgtgctgcaccgcgtccatcatgggcctctgcatcatc
tccatcgaccgctacatcggcgtgagctacccgctgcgctacccaaccatcgtcacccag
aggaggggtctcatggctctgctctgcgtctgggcactctccctggtcatatccattgga
cccctgttcggctggaggcagccggcccccgaggacgagaccatctgccagatcaacgag
gagccgggctacgtgctcttctcagcgctgggctccttctacctgcctctggccatcatc
ctggtcatgtactgccgcgtctacgtggtggccaagagggagagccggggcctcaagtct
ggcctcaagaccgacaagtcggactcggagcaagtgacgctccgcatccatcggaaaaac
gccccggcaggaggcagcgggatggccagcgccaagaccaagacgcacttctcagtgagg
ctcctcaagttctcccgggagaagaaagcggccaaaacgctgggcatcgtggtcggctgc
ttcgtcctctgctggctgccttttttcttagtcatgcccattgggtctttcttccctgat
ttcaagccctctgaaacagtttttaaaatagtattttggctcggatatctaaacagctgc
atcaaccccatcatatacccatgctccagccaagagttcaaaaaggcctttcagaatgtc
ttgagaatccagtgtctctgcagaaagcagtcttccaaacatgccctgggctacaccctg
cacccgcccagccaggccgtggaagggcaacacaaggacatggtgcgcatccccgtggga
tcaagagagaccttctacaggatctccaagacggatggcgtttgtgaatggaaatttttc
tcttccatgccccgtggatctgccaggattacagtgtccaaagaccaatcctcctgtacc
acagcccgggtgagaagtaaaagctttttgcaggtctgctgctgtgtagggccctcaacc
cccagccttgacaagaaccatcaagttccaaccattaaggtccacaccatctccctcagt
gagaacggggaggaagtctag

DBGET integrated database retrieval system