KEGG   Homo sapiens (human): 1490Help
Entry
1490              CDS       T01001                                 

Gene name
CTGF, CCN2, HCS24, IGFBP8, NOV2
Definition
(RefSeq) connective tissue growth factor
  KO
K06827  
connective tissue growth factor
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    1490 (CTGF)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-6
    ITGB1; integrin beta 1 [KO:K05719]
     1490 (CTGF)
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     1490 (CTGF)
   VNR
     1490 (CTGF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q23.1
AA seq 349 aa AA seqDB search
MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC
KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT
LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgccagtatgggccccgtccgcgtcgccttcgtggtcctcctcgccctctgc
agccggccggccgtcggccagaactgcagcgggccgtgccggtgcccggacgagccggcg
ccgcgctgcccggcgggcgtgagcctcgtgctggacggctgcggctgctgccgcgtctgc
gccaagcagctgggcgagctgtgcaccgagcgcgacccctgcgacccgcacaagggcctc
ttctgtgacttcggctccccggccaaccgcaagatcggcgtgtgcaccgccaaagatggt
gctccctgcatcttcggtggtacggtgtaccgcagcggagagtccttccagagcagctgc
aagtaccagtgcacgtgcctggacggggcggtgggctgcatgcccctgtgcagcatggac
gttcgtctgcccagccctgactgccccttcccgaggagggtcaagctgcccgggaaatgc
tgcgaggagtgggtgtgtgacgagcccaaggaccaaaccgtggttgggcctgccctcgcg
gcttaccgactggaagacacgtttggcccagacccaactatgattagagccaactgcctg
gtccagaccacagagtggagcgcctgttccaagacctgtgggatgggcatctccacccgg
gttaccaatgacaacgcctcctgcaggctagagaagcagagccgcctgtgcatggtcagg
ccttgcgaagctgacctggaagagaacattaagaagggcaaaaagtgcatccgtactccc
aaaatctccaagcctatcaagtttgagctttctggctgcaccagcatgaagacataccga
gctaaattctgtggagtatgtaccgacggccgatgctgcaccccccacagaaccaccacc
ctgccggtggagttcaagtgccctgacggcgaggtcatgaagaagaacatgatgttcatc
aagacctgtgcctgccattacaactgtcccggagacaatgacatctttgaatcgctgtac
tacaggaagatgtacggagacatggcatga

DBGET integrated database retrieval system