KEGG   Homo sapiens (human): 1490Help
Entry
1490              CDS       T01001                                 

Gene name
CTGF, CCN2, HCS24, IGFBP8, NOV2
Definition
(RefSeq) connective tissue growth factor
  KO
K06827  connective tissue growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04371  Apelin signaling pathway
hsa04390  Hippo signaling pathway
Drug target
Pamrevlumab: D10969
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    1490 (CTGF)
   04371 Apelin signaling pathway
    1490 (CTGF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_knot VWC IGFBP TSP_1
Motif
Other DBs
NCBI-GeneID: 1490
NCBI-ProteinID: NP_001892
OMIM: 121009
HGNC: 2500
Ensembl: ENSG00000118523
Vega: OTTHUMG00000015573
Pharos: P29279(Tbio)
UniProt: P29279 Q5M8T4
Position
6q23.2
AA seq 349 aa AA seqDB search
MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC
KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT
LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgccagtatgggccccgtccgcgtcgccttcgtggtcctcctcgccctctgc
agccggccggccgtcggccagaactgcagcgggccgtgccggtgcccggacgagccggcg
ccgcgctgcccggcgggcgtgagcctcgtgctggacggctgcggctgctgccgcgtctgc
gccaagcagctgggcgagctgtgcaccgagcgcgacccctgcgacccgcacaagggcctc
ttctgtgacttcggctccccggccaaccgcaagatcggcgtgtgcaccgccaaagatggt
gctccctgcatcttcggtggtacggtgtaccgcagcggagagtccttccagagcagctgc
aagtaccagtgcacgtgcctggacggggcggtgggctgcatgcccctgtgcagcatggac
gttcgtctgcccagccctgactgccccttcccgaggagggtcaagctgcccgggaaatgc
tgcgaggagtgggtgtgtgacgagcccaaggaccaaaccgtggttgggcctgccctcgcg
gcttaccgactggaagacacgtttggcccagacccaactatgattagagccaactgcctg
gtccagaccacagagtggagcgcctgttccaagacctgtgggatgggcatctccacccgg
gttaccaatgacaacgcctcctgcaggctagagaagcagagccgcctgtgcatggtcagg
ccttgcgaagctgacctggaagagaacattaagaagggcaaaaagtgcatccgtactccc
aaaatctccaagcctatcaagtttgagctttctggctgcaccagcatgaagacataccga
gctaaattctgtggagtatgtaccgacggccgatgctgcaccccccacagaaccaccacc
ctgccggtggagttcaagtgccctgacggcgaggtcatgaagaagaacatgatgttcatc
aagacctgtgcctgccattacaactgtcccggagacaatgacatctttgaatcgctgtac
tacaggaagatgtacggagacatggcatga

DBGET integrated database retrieval system