KEGG   Homo sapiens (human): 1493Help
Entry
1493              CDS       T01001                                 

Gene name
CTLA4, CD, CD152, CELIAC3, CTLA-4, GRD4, GSE, IDDM12
Definition
cytotoxic T-lymphocyte-associated protein 4
Orthology
K06538  
cytotoxic T-lymphocyte-associated protein 4
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
T cell receptor signaling pathway
Autoimmune thyroid disease
Rheumatoid arthritis
Disease
H00081  
Hashimoto's thyroiditis
H00082  
Graves' disease
H00083  
Allograft rejection
H00408  
Type I diabetes mellitus
Drug target
Ipilimumab: 
Belatacept: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1493 (CTLA4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    1493 (CTLA4)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    1493 (CTLA4)
   05320 Autoimmune thyroid disease
    1493 (CTLA4)
Cellular antigens [BR:hsa04090]
 Proteins
  1493 (CTLA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q33
AA seq 174 aa AA seqDB search
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY
ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR
AMDTGLYICKVELMYPPPYYLGIGNGTQIYVIAKEKKPSYNRGLCENAPNRARM
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcttgccttggatttcagcggcacaaggctcagctgaacctggctaccaggacctgg
ccctgcactctcctgttttttcttctcttcatccctgtcttctgcaaagcaatgcacgtg
gcccagcctgctgtggtactggccagcagccgaggcatcgccagctttgtgtgtgagtat
gcatctccaggcaaagccactgaggtccgggtgacagtgcttcggcaggctgacagccag
gtgactgaagtctgtgcggcaacctacatgatggggaatgagttgaccttcctagatgat
tccatctgcacgggcacctccagtggaaatcaagtgaacctcactatccaaggactgagg
gccatggacacgggactctacatctgcaaggtggagctcatgtacccaccgccatactac
ctgggcataggcaacggaacccagatttatgtaattgctaaagaaaagaagccctcttac
aacaggggtctatgtgaaaatgcccccaacagagccagaatgtga

DBGET integrated database retrieval system