KEGG   Homo sapiens (human): 1495Help
Entry
1495              CDS       T01001                                 

Gene name
CTNNA1, CAP102
Definition
catenin (cadherin-associated protein), alpha 1, 102kDa
Orthology
K05691  
catenin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Adherens junction
Tight junction
Leukocyte transendothelial migration
Bacterial invasion of epithelial cells
Pathways in cancer
Endometrial cancer
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Class
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Endometrial cancer [PATH:hsa05213]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:hsa05412]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.2
AA seq 906 aa AA seqDB search
MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKAAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgtccatgcaggcaacataaacttcaagtgggatcctaaaagtctagagatc
aggactctggcagttgagagactgttggagcctcttgttacacaggttacaacccttgta
aacaccaatagtaaagggccctctaataagaagagaggtcgttctaagaaggcccatgtt
ttggctgcatctgttgaacaagcaactgagaatttcttggagaagggggataaaattgcg
aaggagagccagtttctcaaggaggagcttgtggctgctgtagaagatgttcgaaaacaa
ggtgatttgatgaaggctgctgcaggagagttcgcagatgatccctgctcttctgtgaag
cgaggcaacatggttcgggcagctcgagctttgctctctgctgttacccggttgctgatt
ttggctgacatggcagatgtctacaaattacttgttcagctgaaagttgtggaagatggt
atcttgaagttgaggaatgctggcaatgaacaagacttaggaatccagtataaagcccta
aaacctgaagtggataagctgaacattatggcagccaaaagacaacaggaattgaaagat
gttggccatcgtgatcagatggctgcagctagaggaatcctgcagaagaacgttccgatc
ctctatactgcatcccaggcatgcctacagcaccctgatgtcgcagcctataaggccaac
agggacctgatatacaagcagctgcagcaggcggtcacaggcatttccaatgcagcccag
gccactgcctcagacgatgcctcacagcaccagggtggaggaggaggagaactggcatat
gcactcaataactttgacaaacaaatcattgtggaccccttgagcttcagcgaggagcgc
tttaggccttccctggaggagcgtctggaaagcatcattagtggggctgccttgatggcc
gactcgtcctgcacgcgtgatgaccgtcgtgagcgaattgtggcagagtgtaatgctgtc
cgccaggccctgcaggacctgctttcggagtacatgggcaatgctggacgtaaagaaaga
agtgatgcactcaattctgcaatagataaaatgaccaagaagaccagggacttgcgtaga
cagctccgcaaagctgtcatggaccacgtttcagattctttcctggaaaccaatgttcca
cttttggtattgattgaagctgcaaagaatggaaatgagaaagaagttaaggagtatgcc
caagttttccgtgaacatgccaacaaattgattgaggttgccaacttggcctgttccatc
tcaaataatgaagaaggtgtaaagcttgttcgaatgtctgcaagccagttagaagccctc
tgtcctcaggttattaatgctgcactggctttagcagcaaaaccacagagtaaactggcc
caagagaacatggatctttttaaagaacaatgggaaaaacaagtccgtgttctcacagat
gctgtcgatgacattacttccattgatgacttcttggctgtctcagagaatcacattttg
gaagatgtgaacaaatgtgtcattgctctccaagagaaggatgtggatggcctggaccgc
acagctggtgcaattcgaggccgggcagcccgggtcattcacgtagtcacctcagagatg
gacaactatgagccaggagtctacacagagaaggttctggaagccactaagctgctctcc
aacacagtcatgccacgttttactgagcaagtagaagcagccgtggaagccctcagctcg
gaccctgcccagcccatggatgagaatgagtttatcgatgcttcccgcctggtatatgat
ggcatccgggacatcaggaaagcagtgctgatgataaggacccctgaggagttggatgac
tctgactttgagacagaagattttgatgtcagaagcaggacgagcgtccagacagaagac
gatcagctgatagctggccagagtgcccgggcgatcatggctcagcttccccaggagcaa
aaagcgaagattgcggaacaggtggccagcttccaggaagaaaagagcaagctggatgct
gaagtgtccaaatgggacgacagtggcaatgacatcattgtgctggccaagcagatgtgc
atgattatgatggagatgacagactttacccgaggtaaaggaccactcaaaaatacatcg
gatgtcatcagtgctgccaagaaaattgctgaggcaggatccaggatggacaagcttggc
cgcaccattgcagaccattgccccgactcggcttgcaagcaggacctgctggcctacctg
caacgcatcgccctctactgccaccagctgaacatctgcagcaaggtcaaggccgaggtg
cagaatctcggcggggagcttgttgtctctggggtggacagcgccatgtccctgatccag
gcagccaagaacttgatgaatgctgtggtgcagacagtgaaggcatcctacgtcgcctct
accaaataccaaaagtcacagggtatggcttccctcaaccttcctgctgtgtcatggaag
atgaaggcaccagagaaaaagccattggtgaagagagagaaacaggatgagacacagacc
aagattaaacgggcatctcagaagaagcacgtgaacccggtgcaggccctcagcgagttc
aaagctatggacagcatctaa

DBGET integrated database retrieval system