KEGG   Homo sapiens (human): 1495Help
Entry
1495              CDS       T01001                                 

Gene name
CTNNA1, CAP102
Definition
catenin (cadherin-associated protein), alpha 1, 102kDa
Orthology
K05691  
catenin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Adherens junction
Tight junction
Leukocyte transendothelial migration
Bacterial invasion of epithelial cells
Pathways in cancer
Endometrial cancer
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    1495 (CTNNA1)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    1495 (CTNNA1)
   04530 Tight junction
    1495 (CTNNA1)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    1495 (CTNNA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1495 (CTNNA1)
   05213 Endometrial cancer
    1495 (CTNNA1)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    1495 (CTNNA1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    1495 (CTNNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.2
AA seq 841 aa AA seqDB search
MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKAAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGNCDTCGALQGLKGWPPPLCWPLTGWTAPC
P
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgtccatgcaggcaacataaacttcaagtgggatcctaaaagtctagagatc
aggactctggcagttgagagactgttggagcctcttgttacacaggttacaacccttgta
aacaccaatagtaaagggccctctaataagaagagaggtcgttctaagaaggcccatgtt
ttggctgcatctgttgaacaagcaactgagaatttcttggagaagggggataaaattgcg
aaggagagccagtttctcaaggaggagcttgtggctgctgtagaagatgttcgaaaacaa
ggtgatttgatgaaggctgctgcaggagagttcgcagatgatccctgctcttctgtgaag
cgaggcaacatggttcgggcagctcgagctttgctctctgctgttacccggttgctgatt
ttggctgacatggcagatgtctacaaattacttgttcagctgaaagttgtggaagatggt
atcttgaagttgaggaatgctggcaatgaacaagacttaggaatccagtataaagcccta
aaacctgaagtggataagctgaacattatggcagccaaaagacaacaggaattgaaagat
gttggccatcgtgatcagatggctgcagctagaggaatcctgcagaagaacgttccgatc
ctctatactgcatcccaggcatgcctacagcaccctgatgtcgcagcctataaggccaac
agggacctgatatacaagcagctgcagcaggcggtcacaggcatttccaatgcagcccag
gccactgcctcagacgatgcctcacagcaccagggtggaggaggaggagaactggcatat
gcactcaataactttgacaaacaaatcattgtggaccccttgagcttcagcgaggagcgc
tttaggccttccctggaggagcgtctggaaagcatcattagtggggctgccttgatggcc
gactcgtcctgcacgcgtgatgaccgtcgtgagcgaattgtggcagagtgtaatgctgtc
cgccaggccctgcaggacctgctttcggagtacatgggcaatgctggacgtaaagaaaga
agtgatgcactcaattctgcaatagataaaatgaccaagaagaccagggacttgcgtaga
cagctccgcaaagctgtcatggaccacgtttcagattctttcctggaaaccaatgttcca
cttttggtattgattgaagctgcaaagaatggaaatgagaaagaagttaaggagtatgcc
caagttttccgtgaacatgccaacaaattgattgaggttgccaacttggcctgttccatc
tcaaataatgaagaaggtgtaaagcttgttcgaatgtctgcaagccagttagaagccctc
tgtcctcaggttattaatgctgcactggctttagcagcaaaaccacagagtaaactggcc
caagagaacatggatctttttaaagaacaatgggaaaaacaagtccgtgttctcacagat
gctgtcgatgacattacttccattgatgacttcttggctgtctcagagaatcacattttg
gaagatgtgaacaaatgtgtcattgctctccaagagaaggatgtggatggcctggaccgc
acagctggtgcaattcgaggccgggcagcccgggtcattcacgtagtcacctcagagatg
gacaactatgagccaggagtctacacagagaaggttctggaagccactaagctgctctcc
aacacagtcatgccacgttttactgagcaagtagaagcagccgtggaagccctcagctcg
gaccctgcccagcccatggatgagaatgagtttatcgatgcttcccgcctggtatatgat
ggcatccgggacatcaggaaagcagtgctgatgataaggacccctgaggagttggatgac
tctgactttgagacagaagattttgatgtcagaagcaggacgagcgtccagacagaagac
gatcagctgatagctggccagagtgcccgggcgatcatggctcagcttccccaggagcaa
aaagcgaagattgcggaacaggtggccagcttccaggaagaaaagagcaagctggatgct
gaagtgtccaaatgggacgacagtggcaatgacatcattgtgctggccaagcagatgtgc
atgattatgatggagatgacagactttacccgaggtaaaggaccactcaaaaatacatcg
gatgtcatcagtgctgccaagaaaattgctgaggcaggatccaggatggacaagcttggc
cgcaccattgcagaccattgccccgactcggcttgcaagcaggacctgctggcctacctg
caacgcatcgccctctactgccaccagctgaacatctgcagcaaggtcaaggccgaggtg
cagaatctcggcggggagcttgttgtctctgggaactgtgacacctgcggggcactgcaa
gggctgaaaggctggcctcctcccctttgctggccactcactgggtggacagcgccatgt
ccctga

DBGET integrated database retrieval system