KEGG   Homo sapiens (human): 1499Help
Entry
1499              CDS       T01001                                 

Gene name
CTNNB1, CTNNB, MRD19, armadillo
Definition
catenin (cadherin-associated protein), beta 1, 88kDa
Orthology
K02105  
catenin beta 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Focal adhesion
Adherens junction
Tight junction
Signaling pathways regulating pluripotency of stem cells
Leukocyte transendothelial migration
Melanogenesis
Thyroid hormone signaling pathway
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Endometrial cancer
Prostate cancer
Thyroid cancer
Basal cell carcinoma
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Disease
H00018  
Gastric cancer
H00020  
Colorectal cancer
H00026  
Endometrial Cancer
H00032  
Thyroid cancer
H00048  
Hepatocellular carcinoma
H00773  
Autosomal dominant mental retardation
H00947  
Pilomatricoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    1499 (CTNNB1)
   04310 Wnt signaling pathway
    1499 (CTNNB1)
   04390 Hippo signaling pathway
    1499 (CTNNB1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    1499 (CTNNB1)
   04520 Adherens junction
    1499 (CTNNB1)
   04530 Tight junction
    1499 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    1499 (CTNNB1)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    1499 (CTNNB1)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    1499 (CTNNB1)
   04916 Melanogenesis
    1499 (CTNNB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1499 (CTNNB1)
   05205 Proteoglycans in cancer
    1499 (CTNNB1)
   05210 Colorectal cancer
    1499 (CTNNB1)
   05216 Thyroid cancer
    1499 (CTNNB1)
   05217 Basal cell carcinoma
    1499 (CTNNB1)
   05215 Prostate cancer
    1499 (CTNNB1)
   05213 Endometrial cancer
    1499 (CTNNB1)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    1499 (CTNNB1)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    1499 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    1499 (CTNNB1)
   05166 HTLV-I infection
    1499 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p21
AA seq 781 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctactcaagctgatttgatggagttggacatggccatggaaccagacagaaaagcg
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact
accacagctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggatacctcc
caagtcctgtatgagtgggaacagggattttctcagtccttcactcaagaacaagtagct
gatattgatggacagtatgcaatgactcgagctcagagggtacgagctgctatgttccct
gagacattagatgagggcatgcagatcccatctacacagtttgatgctgctcatcccact
aatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaacttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaactgcta
aatgacgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgctatcatgcgttctcctcagatggtgtctgctattgtacgt
accatgcagaatacaaatgatgtagaaacagctcgttgtaccgctgggaccttgcataac
ctttcccatcatcgtgagggcttactggccatctttaagtctggaggcattcctgccctg
gtgaaaatgcttggttcaccagtggattctgtgttgttttatgccattacaactctccac
aaccttttattacatcaagaaggagctaaaatggcagtgcgtttagctggtgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacgacagactgc
cttcaaattttagcttatggcaaccaagaaagcaagctcatcatactggctagtggtgga
ccccaagctttagtaaatataatgaggacctatacttacgaaaaactactgtggaccaca
agcagagtgctgaaggtgctatctgtctgctctagtaataagccggctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcaacgtcttgttcagaac
tgtctttggactctcaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
ctccttgggactcttgttcagcttctgggttcagatgatataaatgtggtcacctgtgca
gctggaattctttctaacctcacttgcaataattataagaacaagatgatggtctgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgggctggtgacagggaagacatc
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaagaagcagagatg
gcccagaatgcagttcgccttcactatggactaccagttgtggttaagctcttacaccca
ccatcccactggcctctgataaaggctactgttggattgattcgaaatcttgccctttgt
cccgcaaatcatgcacctttgcgtgagcagggtgccattccacgactagttcagttgctt
gttcgtgcacatcaggatacccagcgccgtacgtccatgggtgggacacagcagcaattt
gtggagggggtccgcatggaagaaatagttgaaggttgtaccggagcccttcacatccta
gctcgggatgttcacaaccgaattgttatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaacatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaagctgcagaagctattgaagctgagggagccacagctcctctg
acagagttacttcactctaggaatgaaggtgtggcgacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaagattacaagaaacggctttcagttgagctgaccagc
tctctcttcagaacagagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgatcctagctatcgttcttttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggaacatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system