KEGG   Homo sapiens (human): 150Help
Entry
150               CDS       T01001                                 

Gene name
ADRA2A, ADRA2, ADRA2R, ADRAR, ALPHA2AAR, ZNF32
Definition
(RefSeq) adrenoceptor alpha 2A
  KO
K04138  adrenergic receptor alpha-2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Apraclonidine (DG01130): D01008 D07461
Aptazapine maleate: D02972
Atipamezole: D03002
Betanidine: D01603
Brimonidine (DG00442): D02076 D07540
Chlorpromazine (DG00867): D00270 D00789 D03274 D04034 D09819
Clonidine (DG00249): D00281 D00604
Clozapine: D00283
Dapiprazole (DG01140): D03648 D07775
Delequamine hydrochloride: D03672
Detomidine (DG01318): D03702 D07795
Dexmedetomidine (DG00926): D00514 D01205
Dihydroergocristine (DG00284): D07833 D07834
Dipivefrine (DG01129): D01017 D02349
Domazoline fumarate: D03887
Droxidopa: D01277
Ephedrine (DG00227): D00124 D01386 D04018
Epinephrine (DG00013): D00095 D00996 D02149
Epinephryl borate: D04026
Ergoloid mesylates: D02268
Ergometrine (DG00446): D01163 D07905
Etilefrine (DG00210): D01573 D07931
Fadolmidine hydrochloride: D04124
Fluparoxan hydrochloride: D04223
Guanabenz (DG01230): D00605 D04375
Guanadrel: D08029
Guanadrel sulfate: D00607
Guanfacine (DG00250): D00606 D08031
Levonordefrin: D02388
Lofexidine (DG01001): D04765 D08141
Medetomidine (DG01320): D04883 D08165
Metaraminol (DG00218): D01019 D08192
Methyldopa (levorotatory) (DG00248): D00405 D08205
Methylephedrine (DG01229): D01952 D02109 D08206 D09842
Methylergometrine (DG00445): D00680 D08207
Metizoline: D05006
Mianserin (DG00951): D01358 D08216
Mirtazapine (DG02838): D00563 D11056
Moxonidine: D05087
Norepinephrine (DG00212): D00076 D05206 D08284 D09794
Octodrine: D05228
Phenoxybenzamine (DG00285): D00507 D08358
Phentolamine (DG00280): D00509 D08362
Phenylpropanolamine (DG01041): D01224 D05466 D08368
Piribedil: D07305
Propylhexedrine (DG01919): D05637
Pseudoephedrine (DG01042): D00485 D05648 D05649 D08449
Racephedrine Hydrochloride: D08982
Rilmenidine: D08482
Romifidine: D08487
Setiptiline (DG01231): D02034 D08511
Sunepitron hydrochloride: D02569
Tizanidine (DG00773): D00776 D08611
Tolazoline (DG00281): D00997 D08614
Tramazoline (DG01033): D01347 D08624
Xylazine (DG01321): D06344 D08683
Yohimbin (DG00485): D06671 D08685
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    150 (ADRA2A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    150 (ADRA2A)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    150 (ADRA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx T2SSM
Motif
Other DBs
NCBI-GeneID: 150
NCBI-ProteinID: NP_000672
OMIM: 104210
HGNC: 281
Ensembl: ENSG00000150594
Vega: OTTHUMG00000019050
Pharos: P08913(Tclin)
UniProt: P08913
Position
10q25.2
AA seq 465 aa AA seqDB search
MFRQEQPLAEGSFAPMGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLML
LTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAW
CEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVIS
FPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKR
RTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGP
RDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTP
AAGPGEERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPR
TLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgttccgccaggagcagccgttggccgagggcagctttgcgcccatgggctccctgcag
ccggacgcgggcaacgcgagctggaacgggaccgaggcgccggggggcggcgcccgggcc
accccttactccctgcaggtgacgctgacgctggtgtgcctggccggcctgctcatgctg
ctcaccgtgttcggcaacgtgctcgtcatcatcgccgtgttcacgagccgcgcgctcaag
gcgccccaaaacctcttcctggtgtctctggcctcggccgacatcctggtggccacgctc
gtcatccctttctcgctggccaacgaggtcatgggctactggtacttcggcaaggcttgg
tgcgagatctacctggcgctcgacgtgctcttctgcacgtcgtccatcgtgcacctgtgc
gccatcagcctggaccgctactggtccatcacacaggccatcgagtacaacctgaagcgc
acgccgcgccgcatcaaggccatcatcatcaccgtgtgggtcatctcggccgtcatctcc
ttcccgccgctcatctccatcgagaagaagggcggcggcggcggcccgcagccggccgag
ccgcgctgcgagatcaacgaccagaagtggtacgtcatctcgtcgtgcatcggctccttc
ttcgctccctgcctcatcatgatcctggtctacgtgcgcatctaccagatcgccaagcgt
cgcacccgcgtgccacccagccgccggggtccggacgccgtcgccgcgccgccggggggc
accgagcgcaggcccaacggtctgggccccgagcgcagcgcgggcccggggggcgcagag
gccgaaccgctgcccacccagctcaacggcgcccctggcgagcccgcgccggccgggccg
cgcgacaccgacgcgctggacctggaggagagctcgtcttccgaccacgccgagcggcct
ccagggccccgcagacccgagcgcggtccccggggcaaaggcaaggcccgagcgagccag
gtgaagccgggcgacagcctgccgcggcgcgggccgggggcgacggggatcgggacgccg
gctgcagggccgggggaggagcgcgtcggggctgccaaggcgtcgcgctggcgcgggcgg
cagaaccgcgagaagcgcttcacgttcgtgctggccgtggtcatcggagtgttcgtggtg
tgctggttccccttcttcttcacctacacgctcacggccgtcgggtgctccgtgccacgc
acgctcttcaaattcttcttctggttcggctactgcaacagctcgttgaacccggtcatc
tacaccatcttcaaccacgatttccgccgcgccttcaagaagatcctctgtcggggggac
aggaagcggatcgtgtga

DBGET integrated database retrieval system