KEGG   Homo sapiens (human): 150Help
Entry
150               CDS       T01001                                 

Gene name
ADRA2A, ADRA2, ADRA2R, ADRAR, ALPHA2AAR, ZNF32
Definition
adrenoceptor alpha 2A
Orthology
K04138  
adrenergic receptor alpha-2A
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Epinephrine: 
Norepinephrine: 
Oxedrine: 
Metaraminol: 
Ephedrine: 
Methyldopa (levorotatory): 
Clonidine: 
Guanfacine: 
Rilmenidine: 
Phentolamine: 
Tolazoline: 
Phenoxybenzamine: 
Brimonidine: 
Methylergometrine: 
Ergometrine: 
Yohimbin: 
Tizanidine: 
Piribedil: 
Chlorpromazine: 
Levomepromazine: 
Asenapine: 
Dexmedetomidine: 
Mianserin: 
Mirtazapine: 
Pseudoephedrine: 
Dipivefrine: 
Apraclonidine: 
Dapiprazole: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q25.2
AA seq 465 aa AA seqDB search
MFRQEQPLAEGSFAPMGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLML
LTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAW
CEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVIS
FPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKR
RTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGP
RDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTP
AAGPGEERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPR
TLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgttccgccaggagcagccgttggccgagggcagctttgcgcccatgggctccctgcag
ccggacgcgggcaacgcgagctggaacgggaccgaggcgccggggggcggcgcccgggcc
accccttactccctgcaggtgacgctgacgctggtgtgcctggccggcctgctcatgctg
ctcaccgtgttcggcaacgtgctcgtcatcatcgccgtgttcacgagccgcgcgctcaag
gcgccccaaaacctcttcctggtgtctctggcctcggccgacatcctggtggccacgctc
gtcatccctttctcgctggccaacgaggtcatgggctactggtacttcggcaaggcttgg
tgcgagatctacctggcgctcgacgtgctcttctgcacgtcgtccatcgtgcacctgtgc
gccatcagcctggaccgctactggtccatcacacaggccatcgagtacaacctgaagcgc
acgccgcgccgcatcaaggccatcatcatcaccgtgtgggtcatctcggccgtcatctcc
ttcccgccgctcatctccatcgagaagaagggcggcggcggcggcccgcagccggccgag
ccgcgctgcgagatcaacgaccagaagtggtacgtcatctcgtcgtgcatcggctccttc
ttcgctccctgcctcatcatgatcctggtctacgtgcgcatctaccagatcgccaagcgt
cgcacccgcgtgccacccagccgccggggtccggacgccgtcgccgcgccgccggggggc
accgagcgcaggcccaacggtctgggccccgagcgcagcgcgggcccggggggcgcagag
gccgaaccgctgcccacccagctcaacggcgcccctggcgagcccgcgccggccgggccg
cgcgacaccgacgcgctggacctggaggagagctcgtcttccgaccacgccgagcggcct
ccagggccccgcagacccgagcgcggtccccggggcaaaggcaaggcccgagcgagccag
gtgaagccgggcgacagcctgccgcggcgcgggccgggggcgacggggatcgggacgccg
gctgcagggccgggggaggagcgcgtcggggctgccaaggcgtcgcgctggcgcgggcgg
cagaaccgcgagaagcgcttcacgttcgtgctggccgtggtcatcggagtgttcgtggtg
tgctggttccccttcttcttcacctacacgctcacggccgtcgggtgctccgtgccacgc
acgctcttcaaattcttcttctggttcggctactgcaacagctcgttgaacccggtcatc
tacaccatcttcaaccacgatttccgccgcgccttcaagaagatcctctgtcggggggac
aggaagcggatcgtgtga

DBGET integrated database retrieval system