KEGG   Homo sapiens (human): 150Help
Entry
150               CDS       T01001                                 

Gene name
ADRA2A, ADRA2, ADRA2R, ADRAR, ALPHA2AAR, ZNF32
Definition
(RefSeq) adrenoceptor alpha 2A
  KO
K04138  
adrenergic receptor alpha-2A
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Epinephrine [DG:DG00013]: 
Norepinephrine [DG:DG00212]: 
Oxedrine [DG:DG00217]: 
Metaraminol [DG:DG00218]: 
Ephedrine [DG:DG00227]: 
Methyldopa (levorotatory) [DG:DG00248]: 
Clonidine [DG:DG00249]: 
Guanfacine [DG:DG00250]: 
Rilmenidine: 
Phentolamine [DG:DG00280]: 
Tolazoline [DG:DG00281]: 
Phenoxybenzamine [DG:DG00285]: 
Brimonidine [DG:DG00442]: 
Methylergometrine [DG:DG00445]: 
Ergometrine [DG:DG00446]: 
Yohimbin [DG:DG00485]: 
Tizanidine [DG:DG00773]: 
Piribedil: 
Chlorpromazine [DG:DG00867]: 
Levomepromazine [DG:DG00868]: 
Asenapine: 
Dexmedetomidine [DG:DG00926]: 
Mianserin [DG:DG00951]: 
Mirtazapine: 
Pseudoephedrine [DG:DG01042]: 
Dipivefrine [DG:DG01129]: 
Apraclonidine [DG:DG01130]: 
Dapiprazole [DG:DG01140]: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    150 (ADRA2A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    150 (ADRA2A)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    150 (ADRA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q25.2
AA seq 465 aa AA seqDB search
MFRQEQPLAEGSFAPMGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLML
LTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAW
CEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVIS
FPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKR
RTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGP
RDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTP
AAGPGEERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPR
TLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgttccgccaggagcagccgttggccgagggcagctttgcgcccatgggctccctgcag
ccggacgcgggcaacgcgagctggaacgggaccgaggcgccggggggcggcgcccgggcc
accccttactccctgcaggtgacgctgacgctggtgtgcctggccggcctgctcatgctg
ctcaccgtgttcggcaacgtgctcgtcatcatcgccgtgttcacgagccgcgcgctcaag
gcgccccaaaacctcttcctggtgtctctggcctcggccgacatcctggtggccacgctc
gtcatccctttctcgctggccaacgaggtcatgggctactggtacttcggcaaggcttgg
tgcgagatctacctggcgctcgacgtgctcttctgcacgtcgtccatcgtgcacctgtgc
gccatcagcctggaccgctactggtccatcacacaggccatcgagtacaacctgaagcgc
acgccgcgccgcatcaaggccatcatcatcaccgtgtgggtcatctcggccgtcatctcc
ttcccgccgctcatctccatcgagaagaagggcggcggcggcggcccgcagccggccgag
ccgcgctgcgagatcaacgaccagaagtggtacgtcatctcgtcgtgcatcggctccttc
ttcgctccctgcctcatcatgatcctggtctacgtgcgcatctaccagatcgccaagcgt
cgcacccgcgtgccacccagccgccggggtccggacgccgtcgccgcgccgccggggggc
accgagcgcaggcccaacggtctgggccccgagcgcagcgcgggcccggggggcgcagag
gccgaaccgctgcccacccagctcaacggcgcccctggcgagcccgcgccggccgggccg
cgcgacaccgacgcgctggacctggaggagagctcgtcttccgaccacgccgagcggcct
ccagggccccgcagacccgagcgcggtccccggggcaaaggcaaggcccgagcgagccag
gtgaagccgggcgacagcctgccgcggcgcgggccgggggcgacggggatcgggacgccg
gctgcagggccgggggaggagcgcgtcggggctgccaaggcgtcgcgctggcgcgggcgg
cagaaccgcgagaagcgcttcacgttcgtgctggccgtggtcatcggagtgttcgtggtg
tgctggttccccttcttcttcacctacacgctcacggccgtcgggtgctccgtgccacgc
acgctcttcaaattcttcttctggttcggctactgcaacagctcgttgaacccggtcatc
tacaccatcttcaaccacgatttccgccgcgccttcaagaagatcctctgtcggggggac
aggaagcggatcgtgtga

DBGET integrated database retrieval system