KEGG   Homo sapiens (human): 1506Help
Entry
1506              CDS       T01001                                 

Gene name
CTRL, CTRL1
Definition
chymotrypsin-like (EC:3.4.21.-)
Orthology
K09632  
chymotrypsin-like protease [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    1506 (CTRL)
   04974 Protein digestion and absorption
    1506 (CTRL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     1506 (CTRL)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   1506 (CTRL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
16q22.1
AA seq 264 aa AA seqDB search
MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFC
GGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNN
DVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALP
LVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCN
VRAPAVYTRVSKFSTWINQVIAYN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgctcagcctgaccctaagcctggttctcctcggctcctcctggggctgcggc
attcctgccatcaaaccggcactgagcttcagccagaggattgtcaacggggagaatgca
gtgttgggctcctggccctggcaggtgtccctgcaggacagcagcggcttccacttctgc
ggtggttctctcatcagccagtcctgggtggtcactgctgcccactgcaatgtcagccct
ggccgccattttgttgtcctgggcgagtatgaccgatcatcaaacgcagagcccttgcag
gttctgtccgtctctcgggccattacacaccctagctggaactctaccaccatgaacaat
gacgtgacgctgctgaagctcgcctcgccagcccagtacacaacacgcatctcgccagtt
tgcctggcatcctcaaacgaggctctgactgaaggcctcacgtgtgtcaccaccggctgg
ggtcgcctcagtggcgtgggcaatgtgacaccagcacatctgcagcaggtggctttgccc
ctggtcactgtgaatcagtgccggcagtactggggctcaagtatcactgactccatgatc
tgtgcaggtggcgcaggtgcctcctcgtgccagggtgactccggaggccctcttgtctgc
cagaagggaaacacatgggtgcttattggtattgtctcctggggcaccaaaaactgcaat
gtgcgcgcacctgctgtgtatactcgagttagcaagttcagcacctggatcaaccaggtc
atagcctacaactga

DBGET integrated database retrieval system