KEGG   Homo sapiens (human): 1506Help
Entry
1506              CDS       T01001                                 

Gene name
CTRL, CTRL1
Definition
chymotrypsin-like (EC:3.4.21.-)
Orthology
K09632  
chymotrypsin-like protease [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
Pancreatic secretion
Protein digestion and absorption
Class
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
16q22.1
AA seq 264 aa AA seqDB search
MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFC
GGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNN
DVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALP
LVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCN
VRAPAVYTRVSKFSTWINQVIAYN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgctcagcctgaccctaagcctggttctcctcggctcctcctggggctgcggc
attcctgccatcaaaccggcactgagcttcagccagaggattgtcaacggggagaatgca
gtgttgggctcctggccctggcaggtgtccctgcaggacagcagcggcttccacttctgc
ggtggttctctcatcagccagtcctgggtggtcactgctgcccactgcaatgtcagccct
ggccgccattttgttgtcctgggcgagtatgaccgatcatcaaacgcagagcccttgcag
gttctgtccgtctctcgggccattacacaccctagctggaactctaccaccatgaacaat
gacgtgacgctgctgaagctcgcctcgccagcccagtacacaacacgcatctcgccagtt
tgcctggcatcctcaaacgaggctctgactgaaggcctcacgtgtgtcaccaccggctgg
ggtcgcctcagtggcgtgggcaatgtgacaccagcacatctgcagcaggtggctttgccc
ctggtcactgtgaatcagtgccggcagtactggggctcaagtatcactgactccatgatc
tgtgcaggtggcgcaggtgcctcctcgtgccagggtgactccggaggccctcttgtctgc
cagaagggaaacacatgggtgcttattggtattgtctcctggggcaccaaaaactgcaat
gtgcgcgcacctgctgtgtatactcgagttagcaagttcagcacctggatcaaccaggtc
atagcctacaactga

DBGET integrated database retrieval system