KEGG   Homo sapiens (human): 1509Help
Entry
1509              CDS       T01001                                 

Gene name
CTSD, CLN10, CPSD, HEL-S-130P
Definition
(RefSeq) cathepsin D (EC:3.4.23.5)
  KO
K01379  
cathepsin D [EC:3.4.23.5]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid signaling pathway
Lysosome
Apoptosis
Tuberculosis
Disease
H00149  
Neuronal ceroid lipofuscinosis
H00810  
Progressive myoclonic epilepsy (PME/ EPM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    1509 (CTSD)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    1509 (CTSD)
  Cell growth and death
   04210 Apoptosis
    1509 (CTSD)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    1509 (CTSD)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.5  cathepsin D
     1509 (CTSD)
Peptidases [BR:hsa01002]
 Aspartic Peptidases
  Family A1: pepsin family
   1509 (CTSD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1509 (CTSD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.5
AA seq 412 aa AA seqDB search
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcagccctccagccttctgccgctcgccctctgcctgctggctgcacccgcctccgcg
ctcgtcaggatcccgctgcacaagttcacgtccatccgccggaccatgtcggaggttggg
ggctctgtggaggacctgattgccaaaggccccgtctcaaagtactcccaggcggtgcca
gccgtgaccgaggggcccattcccgaggtgctcaagaactacatggacgcccagtactac
ggggagattggcatcgggacgcccccccagtgcttcacagtcgtcttcgacacgggctcc
tccaacctgtgggtcccctccatccactgcaaactgctggacatcgcttgctggatccac
cacaagtacaacagcgacaagtccagcacctacgtgaagaatggtacctcgtttgacatc
cactatggctcgggcagcctctccgggtacctgagccaggacactgtgtcggtgccctgc
cagtcagcgtcgtcagcctctgccctgggcggtgtcaaagtggagaggcaggtctttggg
gaggccaccaagcagccaggcatcaccttcatcgcagccaagttcgatggcatcctgggc
atggcctacccccgcatctccgtcaacaacgtgctgcccgtcttcgacaacctgatgcag
cagaagctggtggaccagaacatcttctccttctacctgagcagggacccagatgcgcag
cctgggggtgagctgatgctgggtggcacagactccaagtattacaagggttctctgtcc
tacctgaatgtcacccgcaaggcctactggcaggtccacctggaccaggtggaggtggcc
agcgggctgaccctgtgcaaggagggctgtgaggccattgtggacacaggcacttccctc
atggtgggcccggtggatgaggtgcgcgagctgcagaaggccatcggggccgtgccgctg
attcagggcgagtacatgatcccctgtgagaaggtgtccaccctgcccgcgatcacactg
aagctgggaggcaaaggctacaagctgtccccagaggactacacgctcaaggtgtcgcag
gccgggaagaccctctgcctgagcggcttcatgggcatggacatcccgccacccagcggg
ccactctggatcctgggcgacgtcttcatcggccgctactacactgtgtttgaccgtgac
aacaacagggtgggcttcgccgaggctgcccgcctctag

DBGET integrated database retrieval system