KEGG   Homo sapiens (human): 1509Help
Entry
1509              CDS       T01001                                 

Gene name
CTSD, CLN10, CPSD, HEL-S-130P
Definition
cathepsin D (EC:3.4.23.5)
Orthology
K01379  
cathepsin D [EC:3.4.23.5]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Tuberculosis
Disease
H00149  
Neuronal ceroid lipofuscinosis
H00810  
Progressive myoclonic epilepsy (PME)
Class
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.5
AA seq 412 aa AA seqDB search
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcagccctccagccttctgccgctcgccctctgcctgctggctgcacccgcctccgcg
ctcgtcaggatcccgctgcacaagttcacgtccatccgccggaccatgtcggaggttggg
ggctctgtggaggacctgattgccaaaggccccgtctcaaagtactcccaggcggtgcca
gccgtgaccgaggggcccattcccgaggtgctcaagaactacatggacgcccagtactac
ggggagattggcatcgggacgcccccccagtgcttcacagtcgtcttcgacacgggctcc
tccaacctgtgggtcccctccatccactgcaaactgctggacatcgcttgctggatccac
cacaagtacaacagcgacaagtccagcacctacgtgaagaatggtacctcgtttgacatc
cactatggctcgggcagcctctccgggtacctgagccaggacactgtgtcggtgccctgc
cagtcagcgtcgtcagcctctgccctgggcggtgtcaaagtggagaggcaggtctttggg
gaggccaccaagcagccaggcatcaccttcatcgcagccaagttcgatggcatcctgggc
atggcctacccccgcatctccgtcaacaacgtgctgcccgtcttcgacaacctgatgcag
cagaagctggtggaccagaacatcttctccttctacctgagcagggacccagatgcgcag
cctgggggtgagctgatgctgggtggcacagactccaagtattacaagggttctctgtcc
tacctgaatgtcacccgcaaggcctactggcaggtccacctggaccaggtggaggtggcc
agcgggctgaccctgtgcaaggagggctgtgaggccattgtggacacaggcacttccctc
atggtgggcccggtggatgaggtgcgcgagctgcagaaggccatcggggccgtgccgctg
attcagggcgagtacatgatcccctgtgagaaggtgtccaccctgcccgcgatcacactg
aagctgggaggcaaaggctacaagctgtccccagaggactacacgctcaaggtgtcgcag
gccgggaagaccctctgcctgagcggcttcatgggcatggacatcccgccacccagcggg
ccactctggatcctgggcgacgtcttcatcggccgctactacactgtgtttgaccgtgac
aacaacagggtgggcttcgccgaggctgcccgcctctag

DBGET integrated database retrieval system