KEGG   Homo sapiens (human): 1509Help
Entry
1509              CDS       T01001                                 

Gene name
CTSD, CLN10, CPSD, HEL-S-130P
Definition
cathepsin D (EC:3.4.23.5)
Orthology
K01379  
cathepsin D [EC:3.4.23.5]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Tuberculosis
Disease
H00149  
Neuronal ceroid lipofuscinosis
H00810  
Progressive myoclonic epilepsy (PME/ EPM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    1509 (CTSD)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    1509 (CTSD)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.5  cathepsin D
     1509 (CTSD)
Peptidases [BR:hsa01002]
 Aspartic Peptidases
  Family A1: pepsin family
   1509 (CTSD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1509 (CTSD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.5
AA seq 412 aa AA seqDB search
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcagccctccagccttctgccgctcgccctctgcctgctggctgcacccgcctccgcg
ctcgtcaggatcccgctgcacaagttcacgtccatccgccggaccatgtcggaggttggg
ggctctgtggaggacctgattgccaaaggccccgtctcaaagtactcccaggcggtgcca
gccgtgaccgaggggcccattcccgaggtgctcaagaactacatggacgcccagtactac
ggggagattggcatcgggacgcccccccagtgcttcacagtcgtcttcgacacgggctcc
tccaacctgtgggtcccctccatccactgcaaactgctggacatcgcttgctggatccac
cacaagtacaacagcgacaagtccagcacctacgtgaagaatggtacctcgtttgacatc
cactatggctcgggcagcctctccgggtacctgagccaggacactgtgtcggtgccctgc
cagtcagcgtcgtcagcctctgccctgggcggtgtcaaagtggagaggcaggtctttggg
gaggccaccaagcagccaggcatcaccttcatcgcagccaagttcgatggcatcctgggc
atggcctacccccgcatctccgtcaacaacgtgctgcccgtcttcgacaacctgatgcag
cagaagctggtggaccagaacatcttctccttctacctgagcagggacccagatgcgcag
cctgggggtgagctgatgctgggtggcacagactccaagtattacaagggttctctgtcc
tacctgaatgtcacccgcaaggcctactggcaggtccacctggaccaggtggaggtggcc
agcgggctgaccctgtgcaaggagggctgtgaggccattgtggacacaggcacttccctc
atggtgggcccggtggatgaggtgcgcgagctgcagaaggccatcggggccgtgccgctg
attcagggcgagtacatgatcccctgtgagaaggtgtccaccctgcccgcgatcacactg
aagctgggaggcaaaggctacaagctgtccccagaggactacacgctcaaggtgtcgcag
gccgggaagaccctctgcctgagcggcttcatgggcatggacatcccgccacccagcggg
ccactctggatcctgggcgacgtcttcatcggccgctactacactgtgtttgaccgtgac
aacaacagggtgggcttcgccgaggctgcccgcctctag

DBGET integrated database retrieval system