KEGG   Homo sapiens (human): 1512Help
Entry
1512              CDS       T01001                                 

Gene name
CTSH, ACC-4, ACC-5, ACC4, ACC5, CPSB
Definition
(RefSeq) cathepsin H (EC:3.4.22.16)
  KO
K01366  
cathepsin H [EC:3.4.22.16]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Apoptosis
Disease
H00408  
Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    1512 (CTSH)
  Cell growth and death
   04210 Apoptosis
    1512 (CTSH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.16  cathepsin H
     1512 (CTSH)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C1: papain family
   1512 (CTSH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
15q25.1
AA seq 335 aa AA seqDB search
MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFAS
NWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSV
DWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHG
CQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMV
EAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVK
NSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccacgctgccgctgctctgcgccggggcctggctcctgggagtccccgtctgc
ggtgccgccgaactgtgcgtgaactccttagagaagtttcacttcaagtcatggatgtct
aagcaccgtaagacctacagtacggaggagtaccaccacaggctgcagacgtttgccagc
aactggaggaagataaacgcccacaacaatgggaaccacacatttaaaatggcactgaac
caattttcagacatgagctttgctgaaataaaacacaagtatctctggtcagagcctcag
aattgctcagccaccaaaagtaactaccttcgaggtactggtccctacccaccttccgtg
gactggcggaaaaaaggaaattttgtctcacctgtgaaaaatcagggtgcctgcggcagt
tgctggactttctccaccactggggccctggagtctgcgatcgccatcgcaaccggaaag
atgctgtccttggcggaacagcagctggtggactgcgcccaggacttcaataatcacggc
tgccaagggggtctccccagccaggctttcgagtatatcctgtacaacaaggggatcatg
ggtgaagacacctacccctaccagggcaaggatggttattgcaagttccaacctggaaag
gccatcggctttgtcaaggatgtagccaacatcacaatctatgacgaggaagcgatggtg
gaggctgtggccctctacaaccctgtgagctttgcctttgaggtgactcaggacttcatg
atgtatagaacgggcatctactccagtacttcctgccataaaactccagataaagtaaac
catgcagtactggctgttgggtatggagaaaaaaatgggatcccttactggatcgtgaaa
aactcttggggtccccagtggggaatgaacgggtacttcctcatcgagcgcggaaagaac
atgtgtggcctggctgcctgcgcctcctaccccatccctctggtgtga

DBGET integrated database retrieval system