KEGG   Homo sapiens (human): 151531Help
Entry
151531            CDS       T01001                                 

Gene name
UPP2, UDRPASE2, UP2, UPASE2
Definition
(RefSeq) uridine phosphorylase 2 (EC:2.4.2.3)
  KO
K00757  
uridine phosphorylase [EC:2.4.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    151531 (UPP2)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    151531 (UPP2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.3  uridine phosphorylase
     151531 (UPP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q24.1
AA seq 317 aa AA seqDB search
MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVK
FVCVGGSPNRMKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPS
ISIMLHELIKLLHHARCCDVTIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDN
IVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCTYDFYEGQGRLDGALCSFSREKKLD
YLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLDRLDCDQINLPHDVLVEYQQR
PQLLISNFIRRRLGLCD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagttatacctgcctccaataggtccatgagatctgacaggaatacatatgtt
ggaaaaaggtttgttcacgttaaaaatccttacttggatttgatggatgaagacattctc
tatcacttggatttgggaacaaaaacacacaacctaccagcaatgtttggagatgtaaag
tttgtctgtgtcggtgggagccccaacagaatgaaagcatttgcactgtttatgcacaag
gagctcgggtttgaggaagctgaagaagacataaaagacatctgtgctgggacagacaga
tactgtatgtacaaaaccgggcctgtgctcgccatcagtcacggcatgggcatcccctcc
atttctattatgcttcatgaactcatcaaattactccaccatgcacggtgctgcgatgtc
accattattagaatcggtacatcagggggaatagggattgcaccagggactgttgtaata
acggatatagctgtagactccttctttaagccccggtttgaacaggtcattttggacaac
attgtcacccgaagtactgaactggacaaagaactgtctgaagaactgttcaactgtagc
aaagaaatccccaacttcccaaccctcgttggacatacaatgtgtacctatgatttttat
gaaggccaaggccgactagatggagcactgtgctccttttccagagaaaaaaagttagac
tacttgaagagagcatttaaagctggtgtcaggaatattgaaatggaatctacagtgttt
gcagctatgtgtggactctgtggtctaaaagctgctgtggtctgtgtgacacttctcgac
agactcgactgtgatcagatcaacttgcctcatgatgtcctggtggagtaccagcaacgg
cctcagctcctaatctccaacttcatcagacggcggcttggactttgtgactag

DBGET integrated database retrieval system