KEGG   Homo sapiens (human): 1521Help
Entry
1521              CDS       T01001                                 

Gene name
CTSW, LYPN
Definition
cathepsin W
Orthology
K08569  
cathepsin W [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    1521 (CTSW)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     1521 (CTSW)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C1: papain family
   1521 (CTSW)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.1
AA seq 376 aa AA seqDB search
MALTAHPSCLLALLVAGLAQGIRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHA
HRLDIFAHNLAQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIR
SEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWDFVDVSVQE
LLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKYQKVAWIQDF
IMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTTCDPQLVDHSVLLVGFGS
VKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCGITKFPLT
ARVQKPDMKPRVSCPP
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcactgactgcccacccctcctgcctcctggccctgttggtggcaggcctagcccaa
ggcatcagaggcccccttagggcccaggacctaggtccccagccgctagagctgaaagag
gccttcaagttgttccagatccagttcaaccggagttacctgagcccagaagagcatgct
caccgcctggacatctttgcccacaacctggcccaggctcagaggctgcaggaggaggac
ttgggcacagctgagtttggggtgactccattcagtgacctcacagaggaggagtttggc
cagctctatggctatcggagggcagctggaggggtccccagcatgggcagagaaataagg
tctgaagagccagaggagtcagtacctttcagctgtgactggcggaaggtggccggcgcc
atctcacccatcaaggaccagaaaaactgcaactgctgctgggccatggcagcggcaggc
aacatagagaccctgtggcgcatcagtttctgggattttgtggacgtctccgtgcaggaa
ctgctggactgtggccgctgtggggatggctgccacggtggcttcgtctgggacgcgttc
ataactgtcctcaacaacagcggcctggccagtgaaaaggactacccgttccagggcaaa
gtcagagcccacaggtgccaccccaagaagtaccagaaggtggcctggatccaggacttc
atcatgctgcagaacaacgagcacagaattgcgcagtacctggccacttatggccccatc
accgtgaccatcaacatgaagccccttcagctataccggaaaggtgtgatcaaggccaca
cccaccacctgtgacccccagcttgtggaccactctgtcctgctggtgggttttggcagc
gtcaagtcagaggaggggatatgggcagagacagtctcatcgcagtctcagcctcagcct
ccacaccccaccccatactggatcctgaagaactcctggggggcccaatggggagagaag
ggctatttccggctgcaccgagggagcaatacctgtggcatcaccaagttcccgctcact
gcccgtgtgcagaaaccggatatgaagccccgagtctcctgccctccctga

DBGET integrated database retrieval system