KEGG   Homo sapiens (human): 1524Help
Entry
1524              CDS       T01001                                 

Gene name
CX3CR1, CCRL1, CMKBRL1, CMKDR1, GPR13, GPRV28, V28
Definition
chemokine (C-X3-C motif) receptor 1
Orthology
K04192  
CX3C chemokine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Disease
H00821  
Macular degeneration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1524 (CX3CR1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    1524 (CX3CR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CX3C Chemokine
    1524 (CX3CR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CX3C Chemokine
   1524 (CX3CR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 355 aa AA seqDB search
MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSK
KPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFI
TVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYP
EVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVF
FLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF
RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatcagttccctgaatcagtgacagaaaactttgagtacgatgatttggctgaggcc
tgttatattggggacatcgtggtctttgggactgtgttcctgtccatattctactccgtc
atctttgccattggcctggtgggaaatttgttggtagtgtttgccctcaccaacagcaag
aagcccaagagtgtcaccgacatttacctcctgaacctggccttgtctgatctgctgttt
gtagccactttgcccttctggactcactatttgataaatgaaaagggcctccacaatgcc
atgtgcaaattcactaccgccttcttcttcatcggcttttttggaagcatattcttcatc
accgtcatcagcattgataggtacctggccatcgtcctggccgccaactccatgaacaac
cggaccgtgcagcatggcgtcaccatcagcctaggcgtctgggcagcagccattttggtg
gcagcaccccagttcatgttcacaaagcagaaagaaaatgaatgccttggtgactacccc
gaggtcctccaggaaatctggcccgtgctccgcaatgtggaaacaaattttcttggcttc
ctactccccctgctcattatgagttattgctacttcagaatcatccagacgctgttttcc
tgcaagaaccacaagaaagccaaagccattaaactgatccttctggtggtcatcgtgttt
ttcctcttctggacaccctacaacgttatgattttcctggagacgcttaagctctatgac
ttctttcccagttgtgacatgaggaaggatctgaggctggccctcagtgtgactgagacg
gttgcatttagccattgttgcctgaatcctctcatctatgcatttgctggggagaagttc
agaagatacctttaccacctgtatgggaaatgcctggctgtcctgtgtgggcgctcagtc
cacgttgatttctcctcatctgaatcacaaaggagcaggcatggaagtgttctgagcagc
aattttacttaccacacgagtgatggagatgcattgctccttctctga

DBGET integrated database retrieval system