KEGG   Homo sapiens (human): 1536Help
Entry
1536              CDS       T01001                                 

Gene name
CYBB, AMCBX2, CGD, GP91-1, GP91-PHOX, GP91PHOX, NOX2, p91-PHOX
Definition
cytochrome b-245, beta polypeptide
Orthology
K08008  
NADPH oxidase
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Phagosome
Osteoclast differentiation
Leukocyte transendothelial migration
Disease
H00098  
Chronic granulomatous disease
H01167  
Gluconobacter infection
Class
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp21.1
AA seq 570 aa AA seqDB search
MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACL
NFNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHL
FNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGV
VITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLAVHN
ITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV
VTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGD
WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
KSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYL
TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPE
ALAETLSKQSISNSESGPRGVHFIFNKENF
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggggaactgggctgtgaatgaggggctctccatttttgtcattctggtttggctgggg
ttgaacgtcttcctctttgtctggtattaccgggtttatgatattccacctaagttcttt
tacacaagaaaacttcttgggtcagcactggcactggccagggcccctgcagcctgcctg
aatttcaactgcatgctgattctcttgccagtctgtcgaaatctgctgtccttcctcagg
ggttccagtgcgtgctgctcaacaagagttcgaagacaactggacaggaatctcaccttt
cataaaatggtggcatggatgattgcacttcactctgcgattcacaccattgcacatcta
tttaatgtggaatggtgtgtgaatgcccgagtcaataattctgatccttattcagtagca
ctctctgaacttggagacaggcaaaatgaaagttatctcaattttgctcgaaagagaata
aagaaccctgaaggaggcctgtacctggctgtgaccctgttggcaggcatcactggagtt
gtcatcacgctgtgcctcatattaattatcacttcctccaccaaaaccatccggaggtct
tactttgaagtcttttggtacacacatcatctctttgtgatcttcttcattggccttgcc
atccatggagctgaacgaattgtacgtgggcagaccgcagagagtttggctgtgcataat
ataacagtttgtgaacaaaaaatctcagaatggggaaaaataaaggaatgcccaatccct
cagtttgctggaaaccctcctatgacttggaaatggatagtgggtcccatgtttctgtat
ctctgtgagaggttggtgcggttttggcgatctcaacagaaggtggtcatcaccaaggtg
gtcactcaccctttcaaaaccatcgagctacagatgaagaagaaggggttcaaaatggaa
gtgggacaatacatttttgtcaagtgcccaaaggtgtccaagctggagtggcaccctttt
acactgacatccgcccctgaggaagacttctttagtatccatatccgcatcgttggggac
tggacagaggggctgttcaatgcttgtggctgtgataagcaggagtttcaagatgcgtgg
aaactacctaagatagcggttgatgggccctttggcactgccagtgaagatgtgttcagc
tatgaggtggtgatgttagtgggagcagggattggggtcacacccttcgcatccattctc
aagtcagtctggtacaaatattgcaataacgccaccaatctgaagctcaaaaagatctac
ttctactggctgtgccgggacacacatgcctttgagtggtttgcagatctgctgcaactg
ctggagagccagatgcaggaaaggaacaatgccggcttcctcagctacaacatctacctc
actggctgggatgagtctcaggccaatcactttgctgtgcaccatgatgaggagaaagat
gtgatcacaggcctgaaacaaaagactttgtatggacggcccaactgggataatgaattc
aagacaattgcaagtcaacaccctaataccagaataggagttttcctctgtggacctgaa
gccttggctgaaaccctgagtaaacaaagcatctccaactctgagtctggccctcgggga
gtgcatttcattttcaacaaggaaaacttctaa

DBGET integrated database retrieval system