KEGG   Homo sapiens (human): 1544Help
Entry
1544              CDS       T01001                                 

Gene name
CYP1A2, CP12, P3-450, P450(PA)
Definition
cytochrome P450, family 1, subfamily A, polypeptide 2 (EC:1.14.14.1)
Orthology
K07409  
cytochrome P450, family 1, subfamily A, polypeptide 2 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Caffeine metabolism
Tryptophan metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:hsa00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:hsa00591]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hsa00380]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:hsa00232]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:hsa00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:hsa00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:hsa05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q24.1
AA seq 516 aa AA seqDB search
MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKN
PHLALSRMSQRYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDG
QSLTFSTDSGPVWAARRRLAQNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELM
AGPGHFDPYNQVVVSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFP
ILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGN
LIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLS
DRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL
WEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLE
FSVPPGVKVDLTPIYGLTMKHARCEHVQARLRFSIN
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcattgtcccagtctgttcccttctcggccacagagcttctcctggcctctgccatc
ttctgcctggtattctgggtgctcaagggtttgaggcctcgggtccccaaaggcctgaaa
agtccaccagagccatggggctggcccttgctcgggcatgtgctgaccctggggaagaac
ccgcacctggcactgtcaaggatgagccagcgctacggggacgtcctgcagatccgcatt
ggctccacgcccgtgctggtgctgagccgcctggacaccatccggcaggccctggtgcgg
cagggcgacgatttcaagggccggcctgacctctacacctccaccctcatcactgatggc
cagagcttgaccttcagcacagactctggaccggtgtgggctgcccgccggcgcctggcc
cagaatgccctcaacaccttctccatcgcctctgacccagcttcctcatcctcctgctac
ctggaggagcatgtgagcaaggaggctaaggccctgatcagcaggttgcaggagctgatg
gcagggcctgggcacttcgacccttacaatcaggtggtggtgtcagtggccaacgtcatt
ggtgccatgtgcttcggacagcacttccctgagagtagcgatgagatgctcagcctcgtg
aagaacactcatgagttcgtggagactgcctcctccgggaaccccctggacttcttcccc
atccttcgctacctgcctaaccctgccctgcagaggttcaaggccttcaaccagaggttc
ctgtggttcctgcagaaaacagtccaggagcactatcaggactttgacaagaacagtgtc
cgggacatcacgggtgccctgttcaagcacagcaagaaggggcctagagccagcggcaac
ctcatcccacaggagaagattgtcaaccttgtcaatgacatctttggagcaggatttgac
acagtcaccacagccatctcctggagcctcatgtaccttgtgaccaagcctgagatacag
aggaagatccagaaggagctggacactgtgattggcagggagcggcggccccggctctct
gacagaccccagctgccctacttggaggccttcatcctggagaccttccgacactcctcc
ttcttgcccttcaccatcccccacagcacaacaagggacacaacgctgaatggcttctac
atccccaagaaatgctgtgtcttcgtaaaccagtggcaggtcaaccatgacccagagctg
tgggaggacccctctgagttccggcctgagcggttcctcaccgccgatggcactgccatt
aacaagcccttgagtgagaagatgatgctgtttggcatgggcaagcgccggtgtatcggg
gaagtcctggccaagtgggagatcttcctcttcctggccatcctgctacagcaactggag
ttcagcgtgccgccgggcgtgaaagtcgacctgacccccatctacgggctgaccatgaag
cacgcccgctgtgaacatgtccaggcgcggctgcgcttctccatcaactga

DBGET integrated database retrieval system