KEGG   Homo sapiens (human): 1545Help
Entry
1545              CDS       T01001                                 

Gene name
CYP1B1, CP1B, CYPIB1, GLC3A, P4501B1
Definition
cytochrome P450, family 1, subfamily B, polypeptide 1 (EC:1.14.14.1)
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Ovarian steroidogenesis
Chemical carcinogenesis
MicroRNAs in cancer
Disease
H00612  
Primary open angle glaucoma
H01075  
Peters anomaly
H01159  
Anterior segment dysgenesis (ASD)
H01203  
Primary congenital glaucoma (PCG)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    1545 (CYP1B1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    1545 (CYP1B1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1545 (CYP1B1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    1545 (CYP1B1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    1545 (CYP1B1)
   05204 Chemical carcinogenesis
    1545 (CYP1B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1545 (CYP1B1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP1 family
   1545 (CYP1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p22.2
AA seq 543 aa AA seqDB search
MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLI
GNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAF
ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVAL
LVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSL
VDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSA
EKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL
DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV
FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQL
FLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKE
TCQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccagcctcagcccgaacgacccttggccgctaaacccgctgtccatccagcag
accacgctcctgctactcctgtcggtgctggccactgtgcatgtgggccagcggctgctg
aggcaacggaggcggcagctccggtccgcgcccccgggcccgtttgcgtggccactgatc
ggaaacgcggcggcggtgggccaggcggctcacctctcgttcgctcgcctggcgcggcgc
tacggcgacgttttccagatccgcctgggcagctgccccatagtggtgctgaatggcgag
cgcgccatccaccaggccctggtgcagcagggctcggccttcgccgaccggccggccttc
gcctccttccgtgtggtgtccggcggccgcagcatggctttcggccactactcggagcac
tggaaggtgcagcggcgcgcagcccacagcatgatgcgcaacttcttcacgcgccagccg
cgcagccgccaagtcctcgagggccacgtgctgagcgaggcgcgcgagctggtggcgctg
ctggtgcgcggcagcgcggacggcgccttcctcgacccgaggccgctgaccgtcgtggcc
gtggccaacgtcatgagtgccgtgtgtttcggctgccgctacagccacgacgaccccgag
ttccgtgagctgctcagccacaacgaagagttcgggcgcacggtgggcgcgggcagcctg
gtggacgtgatgccctggctgcagtacttccccaacccggtgcgcaccgttttccgcgaa
ttcgagcagctcaaccgcaacttcagcaacttcatcctggacaagttcttgaggcactgc
gaaagccttcggcccggggccgccccccgcgacatgatggacgcctttatcctctctgcg
gaaaagaaggcggccggggactcgcacggtggtggcgcgcggctggatttggagaacgta
ccggccactatcactgacatcttcggcgccagccaggacaccctgtccaccgcgctgcag
tggctgctcctcctcttcaccaggtatcctgatgtgcagactcgagtgcaggcagaattg
gatcaggtcgtggggagggaccgtctgccttgtatgggtgaccagcccaacctgccctat
gtcctggccttcctttatgaagccatgcgcttctccagctttgtgcctgtcactattcct
catgccaccactgccaacacctctgtcttgggctaccacattcccaaggacactgtggtt
tttgtcaaccagtggtctgtgaatcatgacccactgaagtggcctaacccggagaacttt
gatccagctcgattcttggacaaggatggcctcatcaacaaggacctgaccagcagagtg
atgattttttcagtgggcaaaaggcggtgcattggcgaagaactttctaagatgcagctt
tttctcttcatctccatcctggctcaccagtgcgatttcagggccaacccaaatgagcct
gcgaaaatgaatttcagttatggtctaaccattaaacccaagtcatttaaagtcaatgtc
actctcagagagtccatggagctccttgatagtgctgtccaaaatttacaagccaaggaa
acttgccaataa

DBGET integrated database retrieval system