KEGG   Homo sapiens (human): 1551Help
Entry
1551              CDS       T01001                                 

Gene name
CYP3A7, CP37, CYPIIIA7, P450-HFLA
Definition
cytochrome P450, family 3, subfamily A, polypeptide 7 (EC:1.14.14.1)
Orthology
K17691  
cytochrome P450, family 3, subfamily A, polypeptide 7 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Retinol metabolism
Chemical carcinogenesis
Drug target
Cobicistat: 
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:hsa00140]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:hsa05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21-q22.1
AA seq 503 aa AA seqDB search
MDLIPNLAVETWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKGYWTF
DMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKNAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYS
MDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKVFPFLTPILEALNITV
FPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVV
NETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWREPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFG
GLLLTEKPIVLKAESRDETVSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctcatcccaaacttggccgtggaaacctggcttctcctggctgtcagcctgata
ctcctctatctatatggaacccgtacacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttttgggaaatgctttgtccttccgtaagggctattggacgttt
gacatggaatgttataaaaagtatagaaaagtctggggtatttatgactgtcaacagcct
atgctggctatcacagatcccgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggcctttcgggccagtgggatttatgaaaaatgccatctctata
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaacattcaccagcgga
aaactcaaggagatggtccctatcattgcccagtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaacacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgagcatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttaatccattagatccattcgtt
ctctcaataaaagtctttccattccttaccccaattcttgaagcattaaatatcactgtg
tttccaagaaaagttataagttttctaacaaaatctgtaaaacagataaaagaaggtcgc
ctcaaagagacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcaaaagactctgagacccacaaagctctgtctgatctggagctcatggcccaatcaatt
atctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatatatgaa
ctggccactcaccctgatgtccagcagaaagtgcagaaggaaattgatacagttttaccc
aataaggcaccacccacctatgatactgtgctacagttggagtatcttgacatggtggtg
aatgaaacactcagattattcccagttgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatgtttattcccaaaggggtggtggtgatgattccaagctatgtt
cttcatcatgacccaaagtactggagagagcctgagaagttcctccctgaaaggttcagt
aaaaagaacaaggacaacatagatccttacatatacacaccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcgtgaacatgaaacttgctctagtcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgctttgga
ggacttcttctaacagaaaaacccattgttctaaaggctgagtcaagggatgagaccgta
agtggagcctga

DBGET integrated database retrieval system