KEGG   Homo sapiens (human): 1551Help
Entry
1551              CDS       T01001                                 

Gene name
CYP3A7, CP37, CYPIIIA7, P-450(HFL33), P-450111A7, P450-HFLA
Definition
cytochrome P450, family 3, subfamily A, polypeptide 7 (EC:1.14.14.1)
Orthology
K17691  
cytochrome P450, family 3, subfamily A, polypeptide 7 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Drug target
Cobicistat: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    1551 (CYP3A7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1551 (CYP3A7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    1551 (CYP3A7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1551 (CYP3A7)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP3 family
   1551 (CYP3A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21-q22.1
AA seq 503 aa AA seqDB search
MDLIPNLAVETWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKGYWTF
DMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKNAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYS
MDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKVFPFLTPILEALNITV
FPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVV
NETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFG
GLLLTEKPIVLKAESRDETVSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctcatcccaaacttggccgtggaaacctggcttctcctggctgtcagcctgata
ctcctctatctatatggaacccgtacacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttttgggaaatgctttgtccttccgtaagggctattggacgttt
gacatggaatgttataaaaagtatagaaaagtctggggtatttatgactgtcaacagcct
atgctggctatcacagatcccgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggcctttcgggccagtgggatttatgaaaaatgccatctctata
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaacattcaccagcgga
aaactcaaggagatggtccctatcattgcccagtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaacacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgagcatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttaatccattagatccattcgtt
ctctcaataaaagtctttccattccttaccccaattcttgaagcattaaatatcactgtg
tttccaagaaaagttataagttttctaacaaaatctgtaaaacagataaaagaaggtcgc
ctcaaagagacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcaaaagactctgagacccacaaagctctgtctgatctggagctcatggcccaatcaatt
atctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatatatgaa
ctggccactcaccctgatgtccagcagaaagtgcagaaggaaattgatacagttttaccc
aataaggcaccacccacctatgatactgtgctacagttggagtatcttgacatggtggtg
aatgaaacactcagattattcccagttgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatgtttattcccaaaggggtggtggtgatgattccaagctatgtt
cttcatcatgacccaaagtactggacagagcctgagaagttcctccctgaaaggttcagt
aaaaagaacaaggacaacatagatccttacatatacacaccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcgtgaacatgaaacttgctctagtcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgctttgga
ggacttcttctaacagaaaaacccattgttctaaaggctgagtcaagggatgagaccgta
agtggagcctga

DBGET integrated database retrieval system