KEGG   Homo sapiens (human): 1558Help
Entry
1558              CDS       T01001                                 

Gene name
CYP2C8, CPC8, CYPIIC8, MP-12/MP-20
Definition
cytochrome P450, family 2, subfamily C, polypeptide 8 (EC:1.14.14.1)
Orthology
K17718  
cytochrome P450, family 2, subfamily C, polypeptide 8 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    1558 (CYP2C8)
   00591 Linoleic acid metabolism
    1558 (CYP2C8)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1558 (CYP2C8)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    1558 (CYP2C8)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    1558 (CYP2C8)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    1558 (CYP2C8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1558 (CYP2C8)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1558 (CYP2C8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q23.33
AA seq 490 aa AA seqDB search
MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKV
YGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRW
KEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALT
RSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSD
LVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP
PSYQICFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaccttttgtggtcctggtgctgtgtctctcttttatgcttctcttttcactctgg
agacagagctgtaggagaaggaagctccctcctggccccactcctcttcctattattgga
aatatgctacagatagatgttaaggacatctgcaaatctttcaccaatttctcaaaagtc
tatggtcctgtgttcaccgtgtattttggcatgaatcccatagtggtgtttcatggatat
gaggcagtgaaggaagccctgattgataatggagaggagttttctggaagaggcaattcc
ccaatatctcaaagaattactaaaggacttggaatcatttccagcaatggaaagagatgg
aaggagatccggcgtttctccctcacaaccttgcggaattttgggatggggaagaggagc
attgaggaccgtgttcaagaggaagctcactgccttgtggaggagttgagaaaaaccaag
gcttcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
gttgttttccagaaacgatttgattataaagatcagaattttctcaccctgatgaaaaga
ttcaatgaaaacttcaggattctgaactccccatggatccaggtctgcaataatttccct
ctactcattgattgtttcccaggaactcacaacaaagtgcttaaaaatgttgctcttaca
cgaagttacattagggagaaagtaaaagaacaccaagcatcactggatgttaacaatcct
cgggactttatcgattgcttcctgatcaaaatggagcaggaaaaggacaaccaaaagtca
gaattcaatattgaaaacttggttggcactgtagctgatctatttgttgctggaacagag
acaacaagcaccactctgagatatggactcctgctcctgctgaagcacccagaggtcaca
gctaaagtccaggaagagattgatcatgtaattggcagacacaggagcccctgcatgcag
gataggagccacatgccttacactgatgctgtagtgcacgagatccagagatacagtgac
cttgtccccaccggtgtgccccatgcagtgaccactgatactaagttcagaaactacctc
atccccaagggcacaaccataatggcattactgacttccgtgctacatgatgacaaagaa
tttcctaatccaaatatctttgaccctggccactttctagataagaatggcaactttaag
aaaagtgactacttcatgcctttctcagcaggaaaacgaatttgtgcaggagaaggactt
gcccgcatggagctatttttatttctaaccacaattttacagaactttaacctgaaatct
gttgatgatttaaagaacctcaatactactgcagttaccaaagggattgtttctctgcca
ccctcataccagatctgcttcatccctgtctga

DBGET integrated database retrieval system