KEGG   Homo sapiens (human): 1558Help
Entry
1558              CDS       T01001                                 

Gene name
CYP2C8, CPC8, CYPIIC8, MP-12/MP-20
Definition
cytochrome P450, family 2, subfamily C, polypeptide 8 (EC:1.14.14.1)
Orthology
K17718  
cytochrome P450, family 2, subfamily C, polypeptide 8 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:hsa00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:hsa00982]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:hsa05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q23.33
AA seq 490 aa AA seqDB search
MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKV
YGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRW
KEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALT
RSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSD
LVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP
PSYQICFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaccttttgtggtcctggtgctgtgtctctcttttatgcttctcttttcactctgg
agacagagctgtaggagaaggaagctccctcctggccccactcctcttcctattattgga
aatatgctacagatagatgttaaggacatctgcaaatctttcaccaatttctcaaaagtc
tatggtcctgtgttcaccgtgtattttggcatgaatcccatagtggtgtttcatggatat
gaggcagtgaaggaagccctgattgataatggagaggagttttctggaagaggcaattcc
ccaatatctcaaagaattactaaaggacttggaatcatttccagcaatggaaagagatgg
aaggagatccggcgtttctccctcacaaccttgcggaattttgggatggggaagaggagc
attgaggaccgtgttcaagaggaagctcactgccttgtggaggagttgagaaaaaccaag
gcttcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
gttgttttccagaaacgatttgattataaagatcagaattttctcaccctgatgaaaaga
ttcaatgaaaacttcaggattctgaactccccatggatccaggtctgcaataatttccct
ctactcattgattgtttcccaggaactcacaacaaagtgcttaaaaatgttgctcttaca
cgaagttacattagggagaaagtaaaagaacaccaagcatcactggatgttaacaatcct
cgggactttatcgattgcttcctgatcaaaatggagcaggaaaaggacaaccaaaagtca
gaattcaatattgaaaacttggttggcactgtagctgatctatttgttgctggaacagag
acaacaagcaccactctgagatatggactcctgctcctgctgaagcacccagaggtcaca
gctaaagtccaggaagagattgatcatgtaattggcagacacaggagcccctgcatgcag
gataggagccacatgccttacactgatgctgtagtgcacgagatccagagatacagtgac
cttgtccccaccggtgtgccccatgcagtgaccactgatactaagttcagaaactacctc
atccccaagggcacaaccataatggcattactgacttccgtgctacatgatgacaaagaa
tttcctaatccaaatatctttgaccctggccactttctagataagaatggcaactttaag
aaaagtgactacttcatgcctttctcagcaggaaaacgaatttgtgcaggagaaggactt
gcccgcatggagctatttttatttctaaccacaattttacagaactttaacctgaaatct
gttgatgatttaaagaacctcaatactactgcagttaccaaagggattgtttctctgcca
ccctcataccagatctgcttcatccctgtctga

DBGET integrated database retrieval system