KEGG   Homo sapiens (human): 1576Help
Entry
1576              CDS       T01001                                 

Gene name
CYP3A4, CP33, CP34, CYP3A, CYP3A3, CYPIIIA3, CYPIIIA4, HLP, NF-25, P450C3, P450PCN1
Definition
cytochrome P450, family 3, subfamily A, polypeptide 4 (EC:1.14.13.67 1.14.13.97 1.14.13.32 1.14.13.157)
Orthology
K17689  
cytochrome P450, family 3, subfamily A, polypeptide 4 [EC:1.14.13.32 1.14.13.67 1.14.13.97 1.14.13.157 1.14.13.-]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Bile secretion
Chemical carcinogenesis
Drug target
Cobicistat: 
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:hsa00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:hsa00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:hsa00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:hsa00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:hsa00983]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:hsa05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q21.1
AA seq 502 aa AA seqDB search
MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMF
DMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSIIFPFLIPILEVLNICVF
PREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSII
FIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVN
ETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSK
KNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGG
LLQPEKPVVLKVESRDGTVSGA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggctctcatcccagacttggccatggaaacctggcttctcctggctgtcagcctggtg
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttttgggaaatattttgtcctaccataagggcttttgtatgttt
gacatggaatgtcataaaaagtatggaaaagtgtggggcttttatgatggtcaacagcct
gtgctggctatcacagatcctgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagattacgatcattgctgtctccaaccttcaccagtgga
aaactcaaggagatggtccctatcattgcccagtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaagacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgaacatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttgattttttggatccattcttt
ctctcaataatctttccattcctcatcccaattcttgaagtattaaatatctgtgtgttt
ccaagagaagttacaaattttttaagaaaatctgtaaaaaggatgaaagaaagtcgcctc
gaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaattca
aaagaaactgagtcccacaaagctctgtccgatctggagctcgtggcccaatcaattatc
tttatttttgctggctatgaaaccacgagcagtgttctctccttcattatgtatgaactg
gccactcaccctgatgtccagcagaaactgcaggaggaaattgatgcagttttacccaat
aaggcaccacccacctatgatactgtgctacagatggagtatcttgacatggtggtgaat
gaaacgctcagattattcccaattgctatgagacttgagagggtctgcaaaaaagatgtt
gagatcaatgggatgttcattcccaaaggggtggtggtgatgattccaagctatgctctt
caccgtgacccaaagtactggacagagcctgagaagttcctccctgaaagattcagcaag
aagaacaaggacaacatagatccttacatatacacaccctttggaagtggacccagaaac
tgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtccttcag
aacttctccttcaaaccttgtaaagaaacacagatccccctgaaattaagcttaggagga
cttcttcaaccagaaaaacccgttgttctaaaggttgagtcaagggatggcaccgtaagt
ggagcctga

DBGET integrated database retrieval system