KEGG   Homo sapiens (human): 1577Help
Entry
1577              CDS       T01001                                 

Gene name
CYP3A5, CP35, CYPIIIA5, P450PCN3, PCN3
Definition
cytochrome P450, family 3, subfamily A, polypeptide 5 (EC:1.14.14.1)
Orthology
K17690  
cytochrome P450, family 3, subfamily A, polypeptide 5 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Drug target
Cobicistat: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    1577 (CYP3A5)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1577 (CYP3A5)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1577 (CYP3A5)
   00982 Drug metabolism - cytochrome P450
    1577 (CYP3A5)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    1577 (CYP3A5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1577 (CYP3A5)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP3 family
   1577 (CYP3A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.1
AA seq 502 aa AA seqDB search
MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKF
DTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISL
AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYS
MDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSL
FPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSI
IFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVV
NETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFS
KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQG
LLQPEKPIVLKVDSRDGTLSGE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggacctcatcccaaatttggcggtggaaacctggcttctcctggctgtcagcctggtg
ctcctctatctatatgggacccgtacacatggactttttaagagactgggaattccaggg
cccacacctctgcctttgttgggaaatgttttgtcctatcgtcagggtctctggaaattt
gacacagagtgctataaaaagtatggaaaaatgtggggaacgtatgaaggtcaactccct
gtgctggccatcacagatcccgacgtgatcagaacagtgctagtgaaagaatgttattct
gtcttcacaaatcgaaggtctttaggcccagtgggatttatgaaaagtgccatctcttta
gctgaggatgaagaatggaagagaatacggtcattgctgtctccaaccttcaccagcgga
aaactcaaggagatgttccccatcattgcccagtatggagatgtattggtgagaaacttg
aggcgggaagcagagaaaggcaagcctgtcaccttgaaagacatctttggggcctacagc
atggatgtgattactggcacatcatttggagtgaacatcgactctctcaacaatccacaa
gacccctttgtggagagcactaagaagttcctaaaatttggtttcttagatccattattt
ctctcaataatactctttccattccttaccccagtttttgaagcattaaatgtctctctg
tttccaaaagataccataaattttttaagtaaatctgtaaacagaatgaagaaaagtcgc
ctcaacgacaaacaaaagcaccgactagatttccttcagctgatgattgactcccagaat
tcgaaagaaactgagtcccacaaagctctgtctgatctggagctcgcagcccagtcaata
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcactttatatgaa
ctggccactcaccctgatgtccagcagaaactgcaaaaggagattgatgcagttttgccc
aataaggcaccacctacctatgatgccgtggtacagatggagtaccttgacatggtggtg
aatgaaacactcagattattcccagttgctattagacttgagaggacttgcaagaaagat
gttgaaatcaatggggtattcattcccaaagggtcaatggtggtgattccaacttatgct
cttcaccatgacccaaagtactggacagagcctgaggagttccgccctgaaaggttcagt
aagaagaaggacagcatagatccttacatatacacaccctttggaactggacccagaaac
tgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtccttcag
aacttctccttcaaaccttgtaaagaaacacagatccccttgaaattagacacgcaagga
cttcttcaaccagaaaaacccattgttctaaaggtggattcaagagatggaaccctaagt
ggagaatga

DBGET integrated database retrieval system