KEGG   Homo sapiens (human): 1594Help
Entry
1594              CDS       T01001                                 

Gene name
CYP27B1, CP2B, CYP1, CYP1alpha, CYP27B, P450c1, PDDR, VDD1, VDDR, VDDRI, VDR
Definition
cytochrome P450, family 27, subfamily B, polypeptide 1 (EC:1.14.13.13)
Orthology
K07438  
25-hydroxyvitamin D3 1alpha-hydroxylase [EC:1.14.13.13]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid biosynthesis
Metabolic pathways
Tuberculosis
Module
Cholecalciferol biosynthesis
Disease
H00408  
Type I diabetes mellitus
H01143  
Vitamin D-dependent rickets
Class
Metabolism; Lipid metabolism; Steroid biosynthesis [PATH:hsa00100]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q14.1
AA seq 508 aa AA seqDB search
MTQTLKYASRVFHRVRWAPELGASLGYREYHSARRSLADIPGPSTPSFLAELFCKGGLSR
LHELQVQGAAHFGPVWLASFGTVRTVYVAAPALVEELLRQEGPRPERCSFSPWTEHRRCR
QRACGLLTAEGEEWQRLRSLLAPLLLRPQAAARYAGTLNNVVCDLVRRLRRQRGRGTGPP
ALVRDVAGEFYKFGLEGIAAVLLGSRLGCLEAQVPPDTETFIRAVGSVFVSTLLTMAMPH
WLRHLVPGPWGRLCRDWDQMFAFAQRHVERREAEAAMRNGGQPEKDLESGAHLTHFLFRE
ELPAQSILGNVTELLLAGVDTVSNTLSWALYELSRHPEVQTALHSEITAALSPGSSAYPS
ATVLSQLPLLKAVVKEVLRLYPVVPGNSRVPDKDIHVGDYIIPKNTLVTLCHYATSRDPA
QFPEPNSFRPARWLGEGPTPHPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEVQP
EPGAAPVRPKTRTVLVPERSINLQFLDR
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccctcaagtacgcctccagagtgttccatcgcgtccgctgggcgcccgag
ttgggcgcctccctaggctaccgagagtaccactcagcacgccggagcttggcagacatc
ccaggcccctctacgcccagctttctggccgaacttttctgcaagggggggctgtcgagg
ctacacgagctgcaggtgcagggcgccgcgcacttcgggccggtgtggctagccagcttt
gggacagtgcgcaccgtgtacgtggctgcccctgcactcgtcgaggagctgctgcgacag
gagggaccccggcccgagcgctgcagcttctcgccctggacggagcaccgccgctgccgc
cagcgggcttgcggactgctcactgcggaaggcgaagaatggcaaaggctccgcagtctc
ctggccccgctcctcctccggcctcaagcggccgcccgctacgccggaaccctgaacaac
gtagtctgcgaccttgtgcggcgtctgaggcgccagcggggacgtggcacggggccgccc
gccctggttcgggacgtggcgggggaattttacaagttcggactggaaggcatcgccgcg
gttctgctcggctcgcgcttgggctgcctggaggctcaagtgccacccgacacggagacc
ttcatccgcgctgtgggctcggtgtttgtgtccacgctgttgaccatggcgatgccccac
tggctgcgccaccttgtgcctgggccctggggccgcctctgccgagactgggaccagatg
tttgcatttgctcagaggcacgtggagcggcgagaggcagaggcagccatgaggaacgga
ggacagcccgagaaggacctggagtctggggcgcacctgacccacttcctgttccgggaa
gagttgcctgcccagtccatcctgggaaatgtgacagagttgctattggcgggagtggac
acggtgtccaacacgctctcttgggctctgtatgagctctcccggcaccccgaagtccag
acagcactccactcagagatcacagctgccctgagccctggctccagtgcctacccctca
gccactgttctgtcccagctgcccctgctgaaggcggtggtcaaggaagtgctaagactg
taccctgtggtacctggaaattctcgtgtcccagacaaagacattcatgtgggtgactat
attatccccaaaaatacgctggtcactctgtgtcactatgccacttcaagggaccctgcc
cagttcccagagccaaattcttttcgtccagctcgctggctgggggagggtcccaccccc
cacccatttgcatctcttccctttggctttggcaagcgcagctgtatggggagacgcctg
gcagagcttgaattgcaaatggctttggcccagatcctaacacattttgaggtgcagcct
gagccaggtgcggccccagttagacccaagacccggactgtcctggtacctgaaaggagc
atcaacctacagtttttggacagatag

DBGET integrated database retrieval system