KEGG   Homo sapiens (human): 160Help
Entry
160               CDS       T01001                                 

Gene name
AP2A1, ADTAA, AP2-ALPHA, CLAPA1
Definition
(RefSeq) adaptor related protein complex 2 alpha 1 subunit
  KO
K11824  AP-2 complex subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    160 (AP2A1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    160 (AP2A1)
  Nervous system
   04721 Synaptic vesicle cycle
    160 (AP2A1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    160 (AP2A1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    160 (AP2A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   160 (AP2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Alpha_adaptin_C Alpha_adaptinC2 Cnd1 HEAT_2 RIX1 Dymeclin
Motif
Other DBs
NCBI-GeneID: 160
NCBI-ProteinID: NP_055018
OMIM: 601026
HGNC: 561
Ensembl: ENSG00000196961
Vega: OTTHUMG00000183253
Pharos: O95782(Tbio)
UniProt: O95782
Position
19q13.33
AA seq 977 aa AA seqDB search
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASP
DLVPMGEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCVSLAVSRLSRIVSSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVKGRLVECLETVLNKAQEPPKSKKV
QHSNAKNAILFETISLIIHYDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSE
FSHEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAI
REEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAA
KTVFEALQAPACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRAL
LLSTYIKFINLFPETKATIQGVLRAGSQLRNADVELQQRAVEYLTLSSVASTDVLATVLE
EMPPFPERESSILAKLKRKKGPGAGSALDDGRRDPSSNDINGGMEPTPSTVSTPSPSADL
LGLRAAPPPAAPPASAGAGNLLVDVFDGPAAQPSLGPTPEEAFLSELEPPAPESPMALLA
DPAPAADPGPEDIGPPIPEADELLNKFVCKNNGVLFENQLLQIGVKSEFRQNLGRMYLFY
GNKTSVQFQNFSPTVVHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPLL
SVRFRYGGAPQALTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPQQEAQKIFKANHPMD
AEVTKAKLLGFGSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNAQAQMYRLTLRT
SKEPVSRHLCELLAQQF
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgtgtccaagggcgatgggatgcgggggctcgcggtgttcatctccgacatc
cggaactgtaagagcaaagaggcggaaattaagagaatcaacaaggaactggccaacatc
cgctccaagttcaaaggagacaaagccttggatggctacagtaagaaaaaatatgtgtgt
aaactgcttttcatcttcctgcttggccatgacattgactttgggcacatggaggctgtg
aatctgttgagttccaataaatacacagagaagcaaataggttacctgttcatttctgtg
ctggtgaactcgaactcggagctgatccgcctcatcaacaacgccatcaagaatgacctg
gccagccgcaaccccaccttcatgtgcctggccctgcactgcatcgccaacgtgggcagc
cgggagatgggcgaggcctttgccgctgacatcccccgcatcctggtggccggggacagc
atggacagtgtcaagcagagtgcggccctgtgcctccttcgactgtacaaggcctcgcct
gacctggtgcccatgggcgagtggacggcgcgtgtggtacacctgctcaatgaccagcac
atgggtgtggtcacggccgccgtcagcctcatcacctgtctctgcaagaagaacccagat
gacttcaagacgtgcgtctctctggctgtgtcgcgcctgagccggatcgtctcctctgcc
tccaccgacctccaggactacacctactacttcgtcccagcaccctggctctcggtgaag
ctcctgcggctgctgcagtgctacccgcctccagaggatgcggctgtgaaggggcggctg
gtggaatgtctggagactgtgctcaacaaggcccaggagccccccaaatccaagaaggtg
cagcattccaacgccaagaacgccatcctcttcgagaccatcagcctcatcatccactat
gacagtgagcccaacctcctggttcgggcctgcaaccagctgggccagttcctgcagcac
cgggagaccaacctgcgctacctggccctggagagcatgtgcacgctggccagctccgag
ttctcccatgaagccgtcaagacgcacattgacaccgtcatcaatgccctcaagacggag
cgggacgtcagcgtgcggcagcgggcggctgacctcctctacgccatgtgtgaccggagc
aatgccaagcagatcgtgtcggagatgctgcggtacctggagacggcagactacgccatc
cgcgaggagatcgtcctgaaggtggccatcctggccgagaagtacgccgtggactacagc
tggtacgtggacaccatcctcaacctcatccgcattgcgggcgactacgtgagtgaggag
gtgtggtaccgtgtgctacagatcgtcaccaaccgtgatgacgtccagggctatgccgcc
aagaccgtctttgaggcgctccaggcccctgcctgtcacgagaacatggtgaaggttggc
ggctacatccttggggagtttgggaacctgattgctggggacccccgctccagcccccca
gtgcagttctccctgctccactccaagttccatctgtgcagcgtggccacgcgggcgctg
ctgctgtccacctacatcaagttcatcaacctcttccccgagaccaaggccaccatccag
ggcgtcctgcgggccggctcccagctgcgcaatgctgacgtggagctgcagcagcgagcc
gtggagtacctcaccctcagctcagtggccagcaccgacgtcctggccacggtgctggag
gagatgccgcccttccccgagcgcgagtcgtccatcctggccaagctgaaacgcaagaag
gggccaggggccggcagcgccctggacgatggccggagggaccccagcagcaacgacatc
aacgggggcatggagcccacccccagcactgtgtcgacgccctcgccctccgccgacctc
ctggggctgcgggcagcccctcccccggcagcacccccggcttctgcaggagcagggaac
cttctggtggacgtcttcgatggcccggccgcccagcccagcctggggcccacccccgag
gaggccttcctcagcgagctggagccgcctgcccccgagagccccatggctttgctggct
gacccagctccagctgctgacccaggtcctgaggacatcggccctcccattccggaagcc
gatgagttgctgaataagtttgtgtgtaagaacaacggggtcctgttcgagaaccagctg
ctgcagatcggagtcaagtcagagttccgacagaacctgggccgcatgtatctcttctat
ggcaacaagacctcggtgcagttccagaatttctcacccactgtggttcacccgggagac
ctccagactcagctggctgtgcagaccaagcgcgtggcggcgcaggtggacggcggcgcg
caggtgcagcaggtgctcaatatcgagtgcctgcgggacttcctgacgcccccgctgctg
tccgtgcgcttccggtacggtggcgccccccaggccctcaccctgaagctcccagtgacc
atcaacaagttcttccagcccaccgagatggcggcccaggatttcttccagcgctggaag
cagctgagcctccctcaacaggaggcgcagaaaatcttcaaagccaaccaccccatggac
gcagaagttactaaggccaagcttctggggtttggctctgctctcctggacaatgtggac
cccaaccctgagaacttcgtgggggcggggatcatccagactaaagccctgcaggtgggc
tgtctgcttcggctggagcccaatgcccaggcccagatgtaccggctgaccctgcgcacc
agcaaggagcccgtctcccgtcacctgtgtgagctgctggcacagcagttctga

DBGET integrated database retrieval system