KEGG   Homo sapiens (human): 160Help
Entry
160               CDS       T01001                                 

Gene name
AP2A1, ADTAA, AP2-ALPHA, CLAPA1
Definition
adaptor-related protein complex 2, alpha 1 subunit
Orthology
K11824  
AP-2 complex subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    160 (AP2A1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    160 (AP2A1)
  Nervous system
   04721 Synaptic vesicle cycle
    160 (AP2A1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    160 (AP2A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   160 (AP2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.33
AA seq 977 aa AA seqDB search
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASP
DLVPMGEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCVSLAVSRLSRIVSSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVKGRLVECLETVLNKAQEPPKSKKV
QHSNAKNAILFETISLIIHYDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSE
FSHEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAI
REEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAA
KTVFEALQAPACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRAL
LLSTYIKFINLFPETKATIQGVLRAGSQLRNADVELQQRAVEYLTLSSVASTDVLATVLE
EMPPFPERESSILAKLKRKKGPGAGSALDDGRRDPSSNDINGGMEPTPSTVSTPSPSADL
LGLRAAPPPAAPPASAGAGNLLVDVFDGPAAQPSLGPTPEEAFLSELEPPAPESPMALLA
DPAPAADPGPEDIGPPIPEADELLNKFVCKNNGVLFENQLLQIGVKSEFRQNLGRMYLFY
GNKTSVQFQNFSPTVVHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPLL
SVRFRYGGAPQALTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPQQEAQKIFKANHPMD
AEVTKAKLLGFGSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNAQAQMYRLTLRT
SKEPVSRHLCELLAQQF
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgtgtccaagggcgatgggatgcgggggctcgcggtgttcatctccgacatc
cggaactgtaagagcaaagaggcggaaattaagagaatcaacaaggaactggccaacatc
cgctccaagttcaaaggagacaaagccttggatggctacagtaagaaaaaatatgtgtgt
aaactgcttttcatcttcctgcttggccatgacattgactttgggcacatggaggctgtg
aatctgttgagttccaataaatacacagagaagcaaataggttacctgttcatttctgtg
ctggtgaactcgaactcggagctgatccgcctcatcaacaacgccatcaagaatgacctg
gccagccgcaaccccaccttcatgtgcctggccctgcactgcatcgccaacgtgggcagc
cgggagatgggcgaggcctttgccgctgacatcccccgcatcctggtggccggggacagc
atggacagtgtcaagcagagtgcggccctgtgcctccttcgactgtacaaggcctcgcct
gacctggtgcccatgggcgagtggacggcgcgtgtggtacacctgctcaatgaccagcac
atgggtgtggtcacggccgccgtcagcctcatcacctgtctctgcaagaagaacccagat
gacttcaagacgtgcgtctctctggctgtgtcgcgcctgagccggatcgtctcctctgcc
tccaccgacctccaggactacacctactacttcgtcccagcaccctggctctcggtgaag
ctcctgcggctgctgcagtgctacccgcctccagaggatgcggctgtgaaggggcggctg
gtggaatgtctggagactgtgctcaacaaggcccaggagccccccaaatccaagaaggtg
cagcattccaacgccaagaacgccatcctcttcgagaccatcagcctcatcatccactat
gacagtgagcccaacctcctggttcgggcctgcaaccagctgggccagttcctgcagcac
cgggagaccaacctgcgctacctggccctggagagcatgtgcacgctggccagctccgag
ttctcccatgaagccgtcaagacgcacattgacaccgtcatcaatgccctcaagacggag
cgggacgtcagcgtgcggcagcgggcggctgacctcctctacgccatgtgtgaccggagc
aatgccaagcagatcgtgtcggagatgctgcggtacctggagacggcagactacgccatc
cgcgaggagatcgtcctgaaggtggccatcctggccgagaagtacgccgtggactacagc
tggtacgtggacaccatcctcaacctcatccgcattgcgggcgactacgtgagtgaggag
gtgtggtaccgtgtgctacagatcgtcaccaaccgtgatgacgtccagggctatgccgcc
aagaccgtctttgaggcgctccaggcccctgcctgtcacgagaacatggtgaaggttggc
ggctacatccttggggagtttgggaacctgattgctggggacccccgctccagcccccca
gtgcagttctccctgctccactccaagttccatctgtgcagcgtggccacgcgggcgctg
ctgctgtccacctacatcaagttcatcaacctcttccccgagaccaaggccaccatccag
ggcgtcctgcgggccggctcccagctgcgcaatgctgacgtggagctgcagcagcgagcc
gtggagtacctcaccctcagctcagtggccagcaccgacgtcctggccacggtgctggag
gagatgccgcccttccccgagcgcgagtcgtccatcctggccaagctgaaacgcaagaag
gggccaggggccggcagcgccctggacgatggccggagggaccccagcagcaacgacatc
aacgggggcatggagcccacccccagcactgtgtcgacgccctcgccctccgccgacctc
ctggggctgcgggcagcccctcccccggcagcacccccggcttctgcaggagcagggaac
cttctggtggacgtcttcgatggcccggccgcccagcccagcctggggcccacccccgag
gaggccttcctcagcgagctggagccgcctgcccccgagagccccatggctttgctggct
gacccagctccagctgctgacccaggtcctgaggacatcggccctcccattccggaagcc
gatgagttgctgaataagtttgtgtgtaagaacaacggggtcctgttcgagaaccagctg
ctgcagatcggagtcaagtcagagttccgacagaacctgggccgcatgtatctcttctat
ggcaacaagacctcggtgcagttccagaatttctcacccactgtggttcacccgggagac
ctccagactcagctggctgtgcagaccaagcgcgtggcggcgcaggtggacggcggcgcg
caggtgcagcaggtgctcaatatcgagtgcctgcgggacttcctgacgcccccgctgctg
tccgtgcgcttccggtacggtggcgccccccaggccctcaccctgaagctcccagtgacc
atcaacaagttcttccagcccaccgagatggcggcccaggatttcttccagcgctggaag
cagctgagcctccctcaacaggaggcgcagaaaatcttcaaagccaaccaccccatggac
gcagaagttactaaggccaagcttctggggtttggctctgctctcctggacaatgtggac
cccaaccctgagaacttcgtgggggcggggatcatccagactaaagccctgcaggtgggc
tgtctgcttcggctggagcccaatgcccaggcccagatgtaccggctgaccctgcgcacc
agcaaggagcccgtctcccgtcacctgtgtgagctgctggcacagcagttctga

DBGET integrated database retrieval system