KEGG   Homo sapiens (human): 1604Help
Entry
1604              CDS       T01001                                 

Gene name
CD55, CR, CROM, DAF, TC
Definition
CD55 molecule, decay accelerating factor for complement (Cromer blood group)
Orthology
K04006  
decay accelerating factor
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Hematopoietic cell lineage
Viral myocarditis
Disease
H00106  
Complement regulatory protein defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    1604 (CD55)
   04610 Complement and coagulation cascades
    1604 (CD55)
 Human Diseases
  Cardiovascular diseases
   05416 Viral myocarditis
    1604 (CD55)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   1604 (CD55)
  Exosomal proteins of other body fluids (saliva and urine)
   1604 (CD55)
  Exosomal proteins of colorectal cancer cells
   1604 (CD55)
Cellular antigens [BR:hsa04090]
 Proteins
  1604 (CD55)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32
AA seq 381 aa AA seqDB search
MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTV
ITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFP
VGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGI
LFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGER
DHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPT
TVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLS
GHTCFTLTGLLGTLVTMGLLT
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgcgcggccgagcgtgcccgcggcgctgcccctcctcggggagctgccccgg
ctgctgctgctggtgctgttgtgcctgccggccgtgtggggtgactgtggccttccccca
gatgtacctaatgcccagccagctttggaaggccgtacaagttttcccgaggatactgta
ataacgtacaaatgtgaagaaagctttgtgaaaattcctggcgagaaggactcagtgatc
tgccttaagggcagtcaatggtcagatattgaagagttctgcaatcgtagctgcgaggtg
ccaacaaggctaaattctgcatccctcaaacagccttatatcactcagaattattttcca
gtcggtactgttgtggaatatgagtgccgtccaggttacagaagagaaccttctctatca
ccaaaactaacttgccttcagaatttaaaatggtccacagcagtcgaattttgtaaaaag
aaatcatgccctaatccgggagaaatacgaaatggtcagattgatgtaccaggtggcata
ttatttggtgcaaccatctccttctcatgtaacacagggtacaaattatttggctcgact
tctagtttttgtcttatttcaggcagctctgtccagtggagtgacccgttgccagagtgc
agagaaatttattgtccagcaccaccacaaattgacaatggaataattcaaggggaacgt
gaccattatggatatagacagtctgtaacgtatgcatgtaataaaggattcaccatgatt
ggagagcactctatttattgtactgtgaataatgatgaaggagagtggagtggcccacca
cctgaatgcagaggaaaatctctaacttccaaggtcccaccaacagttcagaaacctacc
acagtaaatgttccaactacagaagtctcaccaacttctcagaaaaccaccacaaaaacc
accacaccaaatgctcaagcaacacggagtacacctgtttccaggacaaccaagcatttt
catgaaacaaccccaaataaaggaagtggaaccacttcaggtactacccgtcttctatct
gggcacacgtgtttcacgttgacaggtttgcttgggacgctagtaaccatgggcttgctg
acttag

DBGET integrated database retrieval system