KEGG   Homo sapiens (human): 160428Help
Entry
160428            CDS       T01001                                 

Gene name
ALDH1L2, mtFDH
Definition
aldehyde dehydrogenase 1 family, member L2 (EC:1.5.1.6)
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    160428 (ALDH1L2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     160428 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q23.3
AA seq 923 aa AA seqDB search
MLRRGSQALRRFSTGRVYFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKLPKWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDIIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVP
IIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEGFIQKVVRKLRGED
QEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLA
DVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLL
QYCETGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDYMYLAKEESFGPIMVISKFQNGD
IDGVLQRANSTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcggggcagccaggcgctccggcgcttctccactggccgggtttatttcaaa
aacaagctgaagttggcactaattggccagagcctctttggacaagaagtctatagccac
ctccgcaaagagggccaccgagtagtaggggtgttcacagttccagacaaggatggaaaa
gctgaccctctggctttggctgcagagaaagatgggacccctgtgttcaagcttcctaaa
tggagggtcaagggcaagaccatcaaagaagtggcagaagcctacagatccgtgggtgca
gagctaaatgtgctccctttctgcactcagttcattcccatggatataattgatagtcca
aagcacggctctatcatttatcacccatccatcctgcccaggcacagaggagcctctgct
atcaattggactctaattatgggagataagaaagctgggttttctgttttctgggctgat
gatggcttggatacaggacccatccttcttcagagatcatgtgatgttgaacccaatgat
acagtggatgcactttataatcggtttctttttcctgaaggaatcaaggccatggtagaa
gctgtccaactcatagctgatggaaaagctcctcgtataccccagccagaagaaggggca
acatatgaaggtatccagaaaaaggaaaatgctgagatttcttgggaccagtctgccgaa
gttttacataactggattcgaggtcatgataaagtccctggagcttggacagagataaat
ggacagatggtcactttctatggctcgacattactgaatagctctgtgcctcctggagaa
ccactggaaattaaaggtgccaagaagcctggtctcgttaccaaaaatggacttgttctt
tttggtaacgatggaaaagcactgacggtgagaaatctgcagtttgaagatggaaaaatg
atccctgcctctcagtacttttcaacgggtgagacgtcagtggtagaactgacagctgaa
gaggtgaaagtggcagagaccatcaaggtcatctgggctggaattttaagcaatgtcccc
attattgaagactcaacagacttctttaaatctggagcaagctcaatggatgttgccagg
ctggttgaagagatcagacagaaatgtggtgggcttcagttgcagaatgaagatgtctat
atggccaccaagtttgaaggctttatccaaaaggtcgtgaggaaactgagaggagaagat
caagaggtggagctggttgtagattatatttcaaaggaggtcaatgaaatcatggtaaaa
atgccataccagtgtttcataaatggacagttcacagatgcagacgatggaaagacttac
gacactatcaacccaacagatggatctacaatatgcaaagtatcctacgcttctttggcg
gatgttgataaagcagtagcagcagcaaaagatgcttttgaaaacggtgaatggggaaga
atgaatgcaagagaaagaggaagattgatgtatagacttgcagacctactggaagagaac
caagaagagctggcaactattgaagcccttgattcaggggctgtctataccttggccctg
aagacacacattggaatgtctgtgcaaacattcagatattttgctggctggtgcgacaaa
attcagggttctactattccaatcaaccaggcccgtccaaatcgcaatctgaccttcacc
aagaaagagccactcggtgtctgtgccattattattccctggaactacccgctgatgatg
ctggcatggaagagtgctgcgtgtttggcagcaggcaataccttagtgctcaagccagca
caggtcacgcccttgactgctttgaagtttgcagaactgtctgtgaaagcaggctttcca
aagggggtcatcaacatcattccaggctcaggtggcatagcaggacaacgtctgtctgaa
catcctgacatccgcaaacttggtttcactggatccactcctattggcaaacagatcatg
aagagctgtgctgttagcaacttgaagaaagtttcccttgagcttggtggcaagtctcca
cttataatatttaatgactgtgaacttgacaaggctgtgcgaatgggcatgggagcagta
tttttcaacaaaggagagaactgtattgctgctgggcggttgttcgtggaagaatccatc
cacgacgaatttgtgacaagagtggtagaagaaattaaaaagatgaaaattggtgatcca
cttgacagatccactgatcatgggccccaaaatcataaggctcatctggaaaagctgctg
caatactgtgaaactggagtgaaagaaggggccactttggtgtacgggggaagacaagtc
caaaggccaggctttttcatggagccgaccgtgttcacagatgtggaagactacatgtac
ctcgccaaagaggaatcctttgggcctattatggtcatttctaaattccaaaatggggac
atcgatggagtgttgcagcgagcaaatagtacagagtatggtttggcctcaggggttttt
acaagagacataaacaaagctatgtatgtgagtgaaaaactggaagcaggaactgttttt
attaacacatacaacaagacagatgtggcggccccatttggcggagttaaacaatctggc
tttggaaaagacttaggtgaggaagctctaaatgaatatctcaaaaccaagacggtgaca
ctggaatattag

DBGET integrated database retrieval system