KEGG   Homo sapiens (human): 161Help
Entry
161               CDS       T01001                                 

Gene name
AP2A2, ADTAB, CLAPA2, HIP-9, HIP9, HYPJ
Definition
adaptor-related protein complex 2, alpha 2 subunit
Orthology
K11824  
AP-2 complex subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    161 (AP2A2)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    161 (AP2A2)
  Nervous system
   04721 Synaptic vesicle cycle
    161 (AP2A2)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    161 (AP2A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   161 (AP2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.5
AA seq 940 aa AA seqDB search
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMGLALHCIASVGSREMAEAFAGEIPKVLVAGDTMDSVKQSAALCLLRLYRTSP
DLVPMGDWTSRVVHLLNDQHLGVVTAATSLITTLAQKNPEEFKTSVSLAVSRLSRIVTSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDPAVRGRLTECLETILNKAQEPPKSKKV
QHSNAKNAVLFEAISLIIHHDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSE
FSHEAVKTHIETVINALKTERDVSVRQRAVDLLYAMCDRSNAPQIVAEMLSYLETADYSI
REEIVLKVAILAEKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQIVINRDDVQGYAA
KTVFEALQAPACHENLVKVGGYILGEFGNLIAGDPRSSPLIQFHLLHSKFHLCSVPTRAL
LLSTYIKFVNLFPEVKPTIQDVLRSDSQLRNADVELQQRAVEYLRLSTVASTDILATVLE
EMPPFPERESSILAKLKKKKGPSTVTDLEDTKRDRSVDVNGGPEPAPASTSAVSTPSPSA
DLLGLGAAPPAPAGPPPSSGGSGLLVDVFSDSASVVAPLAPGSEDNFARFVCKNNGVLFE
NQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICSDDLQPNLNLQTKPVDPTVE
GGAQVQQVVNIECVSDFTEAPVLNIQFRYGGTFQNVSVQLPITLNKFFQPTEMASQDFFQ
RWKQLSNPQQEVQNIFKAKHPMDTEVTKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTT
QIGCLLRLEPNLQAQMYRLTLRTSKEAVSQRLCELLSAQF
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgtgtccaagggggacgggatgcggggcctggcggtcttcatctcggatatc
cgcaactgtaaaagtaaagaagcagaaataaaaaggataaacaaggaactggcaaatatc
agatcaaaatttaaaggtgacaaggctcttgatggctatagtaaaaaaaagtacgtctgc
aagttgctcttcatctttctccttggtcatgacattgactttggacacatggaggctgtg
aacctgctgagttcaaacagatacacggaaaagcagatcggctaccttttcatctctgtg
ttggtgaactcaaacagtgagctgatccgcctgatcaacaacgccatcaagaatgacctg
gccagccgcaaccccaccttcatgggcctggccctgcactgcatcgccagcgtgggcagc
cgggagatggccgaggccttcgccggggagatccctaaggtcctcgtagccggagacact
atggacagcgtgaagcagagcgcggccctgtgcttgctgcgcctgtacaggacgtccccc
gatcttgtccccatgggcgactggacatcccgagtggtgcacctgctcaatgaccagcac
ttgggtgtggtaactgcagccacaagtctgatcaccactttagcacagaagaacccagaa
gagtttaaaacctccgtgtctctggctgtctctaggctaagcagaatcgtgacgtctgca
tccacagatctccaggattacacttactattttgtcccggctccctggctgtctgtcaaa
ctgctgagactgctgcagtgctacccacccccagaagaccctgcagtgcgaggccgcctg
actgagtgcctggagaccatcctgaacaaagcccaagaaccgcccaagtcgaagaaggtc
cagcactccaacgcgaagaatgccgtgctcttcgaggccatcagcttaatcattcaccat
gacagtgagccgaacctgctcgtccgtgcctgcaaccagttgggccagtttctgcagcac
cgcgagaccaacctgcgctacctggccctggagagcatgtgcacgctggccagctctgag
ttctcccatgaggctgtcaagacgcacatcgagacggtcatcaacgccctgaagactgag
cgggacgtgagcgtgcggcagcgggccgtggacctcctctacgccatgtgcgaccgcagc
aacgccccacagatcgtggccgagatgctgagctatctggagacagctgactactccatc
cgagaagagattgtgctgaaggtcgccatcctggctgagaagtacgcggtggactacacc
tggtatgtggataccatcttgaacttgatccgaattgctggtgattacgtgagtgaagag
gtgtggtaccgagtcattcagatcgtcatcaaccgggacgacgtgcagggctacgcggcc
aagactgtgttcgaggctcttcaggctcccgcgtgccacgagaacctggtcaaagtgggc
ggctacatcctgggggagtttggaaacttgatagctggagacccgagatccagcccgctg
atccagttccacctgctgcactccaagttccacctgtgcagcgtccccacccgcgcgctg
ctcctgtccacctacatcaagttcgtgaacctcttcccggaggtgaagcccaccatccag
gacgtgctgcgcagcgacagccagctcaggaacgcagacgtggagctgcagcagcgtgct
gtggagtacctgcggctcagcaccgtggccagcaccgacattctggcgaccgtgctggag
gagatgcccccattcccggagcgggagtcctccatcttggcaaagctcaagaagaagaag
ggccccagcacggtgacagacctggaggacaccaagcgggacaggagtgtggacgtgaac
gggggtcctgagcctgccccagccagtaccagcgccgtgtctacgccttctccgtcggca
gacctgctgggtctcggggctgccccccctgcccccgcgggccccccaccctcctccggc
ggcagcgggctgctcgtggacgtgttctcagactcggcctctgtggtcgcgcctctcgct
cctggctccgaagacaactttgccaggtttgtttgtaaaaacaatggtgtgttgtttgaa
aaccagctgcttcaaattggacttaagtctgaatttcggcagaatttaggtcggatgttt
atcttttatggtaataagacctccacgcagttcctaaactttaccccaacactaatctgt
tcagacgaccttcagcctaacctgaacctgcagaccaagcccgtggacccgaccgtggag
gggggcgcgcaggtgcagcaggtggtcaacatagagtgcgtgtccgacttcacggaggcg
ccagtcctcaacattcagttcaggtatgggggcaccttccagaacgtgtctgtgcagctg
cccatcactctcaacaaattcttccagccgacagaaatggcttctcaggatttctttcaa
cgttggaagcagttgagcaatccacagcaggaagtgcagaacatcttcaaagcaaagcac
ccaatggacacagaagtcaccaaagccaagatcattggatttggttctgcacttcttgaa
gaagttgatcctaatcctgcgaatttcgtgggagctggaatcatccacacgaaaaccacc
cagattggatgcctgctgcgcttggagccgaacctgcaagcccagatgtaccggctcacg
ctgcgcacaagtaaggaagccgtttctcagagattatgtgaattgctctcagcgcagttt
tag

DBGET integrated database retrieval system