KEGG   Homo sapiens (human): 1616Help
Entry
1616              CDS       T01001                                 

Gene name
DAXX, BING2, DAP6, EAP1
Definition
death-domain associated protein
Orthology
K02308  
death-associated protein 6
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Amyotrophic lateral sclerosis (ALS)
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:hsa05014]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 740 aa AA seqDB search
MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYK
LENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRP
AKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPR
TRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLC
ELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARH
SLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARR
LRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPS
GMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEE
DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAP
SSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTV
LENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNG
KKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTC
KTSVATQCDPEEIIVLSDSD
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgctaacagcatcatcgtgctggatgatgatgacgaagatgaagcagctgct
cagccagggccctcccacccactccccaatgcggcctcacctggggcagaagcccctagc
tcctctgagcctcatggggccagaggaagcagtagttcgggcggcaagaaatgctacaag
ctggagaatgagaagctgttcgaagagttccttgaactttgtaagatgcagacagcagac
caccctgaggtggtcccattcctctataaccggcagcaacgtgcccactctctgtttttg
gcctcggcggagttctgcaacatcctctctagggtcctgtctcgggcccggagccggcca
gccaagctctatgtctacatcaatgagctctgcactgttctcaaggcccactcagccaaa
aagaagctgaacttggcccctgccgccaccacctccaatgagccctctgggaataaccct
cccacacacctctccttggaccccacaaatgctgaaaacactgcctctcagtctccaagg
acccgtggttcccggcggcagatccagcgtttggagcagctgctggcgctctatgtggca
gagatccggcggctgcaggaaaaggagttggatctctcagaattggatgacccagactcc
gcatacctgcaggaggcacggttgaagcgtaagctgatccgcctctttgggcgactatgt
gagctgaaagactgctcttcactgaccggccgtgtcatagagcagcgcatcccctaccgt
ggcacccgctacccagaggttaacaggcgcattgagcggctcatcaacaagccagggcct
gataccttccctgactatggggatgtgcttcgggctgtagagaaggcagctgcccgacac
agccttggcctcccccgacagcagctccagctcatggctcaggatgccttccgagatgtg
ggcatcaggttacaggagcgacgtcacctcgatctcatctacaactttggctgccacctc
acagatgactataggccaggcgttgaccctgcactatcagatcctgtgttggcccggcgc
cttcgggaaaaccggagtttggccatgagtcggctggatgaggtcatctccaaatatgca
atgttgcaagacaaaagtgaggagggcgagagaaaaaagagaagagctcggctccaaggc
acctcttcccactctgcagacacccccgaagcctccttggattctggtgagggccctagt
ggaatggcatcccaggggtgcccttctgcctccagagctgagacagatgacgaagacgat
gaggagagtgatgaggaagaggaggaggaggaggaagaagaagaggaggaggccacagat
tctgaagaggaggaggatctggaacagatgcaggagggtcaggaggatgatgaagaggag
gacgaagaggaagaagcagcagcaggtaaagatggagacaagagccccatgtcctcacta
cagatctccaatgaaaagaacctggaacctggcaaacagatcagcagatcttcaggggag
cagcaaaacaaaggacgcatagtgtcaccatcgttactgtcagaagaacccctggccccc
tccagcatagatgctgaaagcaatggagaacagcctgaggagctgaccctggaggaagaa
agccctgtgtctcagctctttgagctagagattgaagctttgcccctggataccccttcc
tctgtggagacggacatttcctcttccaggaagcaatcagaggagcccttcaccactgtc
ttagagaatggagcaggcatggtctcttctacttccttcaatggaggcgtctctcctcac
aactggggagattctggtcccccctgcaaaaaatctcggaaggagaagaagcaaacagga
tcagggccattaggaaacagctatgtggaaaggcaaaggtcagtgcatgagaagaatggg
aaaaagatatgtaccctgcccagcccaccttcccccttggcttccttggccccagttgct
gattcctccacgagggtggactctcccagccatggcctggtgaccagctccctctgcatc
ccttctccagcccggctgtcccaaaccccccattcacagcctcctcggcctggtacttgc
aagacaagtgtggccacacaatgcgatccagaagagatcatcgtgctctcagactctgat
tag

DBGET integrated database retrieval system