KEGG   Homo sapiens (human): 1616Help
Entry
1616              CDS       T01001                                 

Gene name
DAXX, BING2, DAP6, EAP1
Definition
death-domain associated protein
Orthology
K02308  
death-associated protein 6
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Amyotrophic lateral sclerosis (ALS)
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    1616 (DAXX)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    1616 (DAXX)
  Infectious diseases
   05168 Herpes simplex infection
    1616 (DAXX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 740 aa AA seqDB search
MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYK
LENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRP
AKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPR
TRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLC
ELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARH
SLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARR
LRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPS
GMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEE
DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAP
SSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTV
LENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNG
KKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTC
KTSVATQCDPEEIIVLSDSD
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgctaacagcatcatcgtgctggatgatgatgacgaagatgaagcagctgct
cagccagggccctcccacccactccccaatgcggcctcacctggggcagaagcccctagc
tcctctgagcctcatggggccagaggaagcagtagttcgggcggcaagaaatgctacaag
ctggagaatgagaagctgttcgaagagttccttgaactttgtaagatgcagacagcagac
caccctgaggtggtcccattcctctataaccggcagcaacgtgcccactctctgtttttg
gcctcggcggagttctgcaacatcctctctagggtcctgtctcgggcccggagccggcca
gccaagctctatgtctacatcaatgagctctgcactgttctcaaggcccactcagccaaa
aagaagctgaacttggcccctgccgccaccacctccaatgagccctctgggaataaccct
cccacacacctctccttggaccccacaaatgctgaaaacactgcctctcagtctccaagg
acccgtggttcccggcggcagatccagcgtttggagcagctgctggcgctctatgtggca
gagatccggcggctgcaggaaaaggagttggatctctcagaattggatgacccagactcc
gcatacctgcaggaggcacggttgaagcgtaagctgatccgcctctttgggcgactatgt
gagctgaaagactgctcttcactgaccggccgtgtcatagagcagcgcatcccctaccgt
ggcacccgctacccagaggttaacaggcgcattgagcggctcatcaacaagccagggcct
gataccttccctgactatggggatgtgcttcgggctgtagagaaggcagctgcccgacac
agccttggcctcccccgacagcagctccagctcatggctcaggatgccttccgagatgtg
ggcatcaggttacaggagcgacgtcacctcgatctcatctacaactttggctgccacctc
acagatgactataggccaggcgttgaccctgcactatcagatcctgtgttggcccggcgc
cttcgggaaaaccggagtttggccatgagtcggctggatgaggtcatctccaaatatgca
atgttgcaagacaaaagtgaggagggcgagagaaaaaagagaagagctcggctccaaggc
acctcttcccactctgcagacacccccgaagcctccttggattctggtgagggccctagt
ggaatggcatcccaggggtgcccttctgcctccagagctgagacagatgacgaagacgat
gaggagagtgatgaggaagaggaggaggaggaggaagaagaagaggaggaggccacagat
tctgaagaggaggaggatctggaacagatgcaggagggtcaggaggatgatgaagaggag
gacgaagaggaagaagcagcagcaggtaaagatggagacaagagccccatgtcctcacta
cagatctccaatgaaaagaacctggaacctggcaaacagatcagcagatcttcaggggag
cagcaaaacaaaggacgcatagtgtcaccatcgttactgtcagaagaacccctggccccc
tccagcatagatgctgaaagcaatggagaacagcctgaggagctgaccctggaggaagaa
agccctgtgtctcagctctttgagctagagattgaagctttgcccctggataccccttcc
tctgtggagacggacatttcctcttccaggaagcaatcagaggagcccttcaccactgtc
ttagagaatggagcaggcatggtctcttctacttccttcaatggaggcgtctctcctcac
aactggggagattctggtcccccctgcaaaaaatctcggaaggagaagaagcaaacagga
tcagggccattaggaaacagctatgtggaaaggcaaaggtcagtgcatgagaagaatggg
aaaaagatatgtaccctgcccagcccaccttcccccttggcttccttggccccagttgct
gattcctccacgagggtggactctcccagccatggcctggtgaccagctccctctgcatc
ccttctccagcccggctgtcccaaaccccccattcacagcctcctcggcctggtacttgc
aagacaagtgtggccacacaatgcgatccagaagagatcatcgtgctctcagactctgat
tag

DBGET integrated database retrieval system