KEGG   Homo sapiens (human): 162387Help
Entry
162387            CDS       T01001                                 

Gene name
MFSD6L
Definition
(RefSeq) major facilitator superfamily domain containing 6 like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 586 aa AA seqDB search
MSANPRWDISRALGVAKLFHLVCGVREACVTPFLTLYLRQLGLAAPWVGTLMGTKHLIAA
FWAPVCAFLAKSYRKRRALLIGSLLGSVGASLLMVLVPPVDKNRVHFPCNGSSGLTSTDA
LPGVTLPVNITSAQESASSHPAKRTAEVEMPGFRNPPGESDRETFRDLHVYLAPSVEGAR
TTSQALLHPVTSGLKDHPWEVTFEVVKTALPLLPGGKGPGNPANLSGTKGKAWAFDLSLE
ALRRTFILSLGSVAFWELLTAPLEQVADDSLYEFLDFVDATDRYRSLWVWRLLGMSAGVC
GITALVGQLDCFLMTSGPRGVVHFYGYSVVSTLALLVSIAFPIPICQQWEPSYKRVKALS
IVGGDPHLILLASTTVLVGAIVSTVQNFLFWHMKDHGSGELVMGFSVALSLLGEILLHPF
KATLLRKLSRTGLVGLGLSCLAGQLLYYSFLWSWWSVLPIQILSAISNRALWWAVGASVE
DLATPRMERALSALFRGHFYGSGCSLGSFVGGFVVMRFSLAVLYQACCVALLLWLALLLS
IQRRLPRERKIKYSKLLSMEVSDTSDSEQGTEQDWLVKAMREEHSD
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccaacccccggtgggacatcagcagggcgctgggggtggccaagctcttccac
ctggtgtgcggggtgcgggaagcctgcgtgaccccgttcctgaccctttacctgaggcag
ctgggcttggccgcgccctgggtgggcaccctaatgggaaccaagcacctaatcgctgcc
ttctgggctcccgtctgtgccttcctggccaaaagctaccggaaaaggagagcgcttctg
atcggctccctgctcggctcggtgggggccagcctgctgatggtcctggtcccaccggta
gacaaaaatcgggtgcacttcccttgtaatggaagcagcggcctgaccagcacagacgca
ctcccgggggtcacgctacctgtgaacatcacctcggcccaagagtctgcctccagccac
ccagccaagaggactgcagaggtggaaatgcctggcttcagaaacccacctggtgaaagt
gaccgagaaactttccgtgatctgcacgtctacttagcgccctccgttgaaggagctagg
accacatcccaagctctcctccatcctgtcacttcggggctgaaagatcatccctgggaa
gttacttttgaggtggtcaagacagccctccccttgcttcctggggggaaagggcccggg
aatccagccaatttgtcagggaccaaggggaaagcctgggcttttgacctgtccttggag
gcgttgcggcggacttttatcctctccttggggtccgtggcgttctgggagctgctgaca
gcgcctctggagcaggtggcagatgacagcctttatgagttcctggattttgtggatgcc
actgaccgatacagaagcctgtgggtctggaggttgctgggcatgtcggcaggcgtgtgt
ggcatcacagccttggtggggcagctggactgcttcctgatgaccagtggcccccgaggt
gtggtccacttctatgggtactcggtggtcagcaccctggccttactggtgagcattgcc
tttcccattcccatctgtcagcagtgggagcccagctacaaaagggtcaaagcactgtcc
attgtggggggtgacccccacctcattctcctcgcctccaccactgttttggtaggagcc
atcgtcagtactgtccagaactttctgttctggcacatgaaggaccatgggagcggcgag
ctggtcatgggtttctcggtcgccctcagcttgctgggggaaattctgcttcatccgttc
aaagctacattgcttaggaaactgtccaggacgggcctggtggggctggggctgagctgc
ctcgctgggcagctgctgtactactctttcctctggagctggtggtccgtcctccccatt
cagatcttgagtgccattagcaacagagctttgtggtgggctgtgggggcctcagtagag
gacctggccactccccgcatggagagggctctgagtgccttgttccgaggccacttttac
gggagtggctgtagcctgggcagctttgtcgggggcttcgtggtgatgcgcttcagcctg
gctgtgctctaccaggcctgctgtgtggccctgttgctctggttggccttgctcctgtcc
atacagcggaggctgccccgagagcggaaaatcaagtactcgaagctgctgtccatggag
gtgagtgacaccagtgactctgagcaggggacagaacaggactggcttgtgaaggccatg
agggaggaacactcagactga

DBGET integrated database retrieval system