KEGG   Homo sapiens (human): 1644Help
Entry
1644              CDS       T01001                                 

Gene name
DDC, AADC
Definition
dopa decarboxylase (aromatic L-amino acid decarboxylase) (EC:4.1.1.28)
Orthology
K01593  
aromatic-L-amino-acid decarboxylase [EC:4.1.1.28]
Organism
hsa  Homo sapiens (human)
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
Melatonin biosynthesis, tryptophan => serotonin => melatonin
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Disease
H01161  
Aromatic L-amino acid decarboxylase (AADC) deficiency
Drug target
Methyldopa (levorotatory): 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    1644 (DDC)
   00350 Tyrosine metabolism
    1644 (DDC)
   00360 Phenylalanine metabolism
    1644 (DDC)
   00380 Tryptophan metabolism
    1644 (DDC)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    1644 (DDC)
   04726 Serotonergic synapse
    1644 (DDC)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    1644 (DDC)
   05031 Amphetamine addiction
    1644 (DDC)
   05034 Alcoholism
    1644 (DDC)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     1644 (DDC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1644 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p12.2
AA seq 480 aa AA seqDB search
MNASEFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM
EKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMV
ATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN
EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaagtgaattccgaaggagagggaaggagatggtggattacgtggccaactac
atggaaggcattgagggacgccaggtctaccctgacgtggagcccgggtacctgcggccg
ctgatccctgccgctgcccctcaggagccagacacgtttgaggacatcatcaacgacgtt
gagaagataatcatgcctggggtgacgcactggcacagcccctacttcttcgcctacttc
cccactgccagctcgtacccggccatgcttgcggacatgctgtgcggggccattggctgc
atcggcttctcctgggcggcaagcccagcatgcacagagctggagactgtgatgatggac
tggctcgggaagatgctggaactaccaaaggcatttttgaatgagaaagctggagaaggg
ggaggagtgatccagggaagtgccagtgaagccaccctggtggccctgctggccgctcgg
accaaagtgatccatcggctgcaggcagcgtccccagagctcacacaggccgctatcatg
gagaagctggtggcttactcatccgatcaggcacactcctcagtggaaagagctgggtta
attggtggagtgaaattaaaagccatcccctcagatggcaacttcgccatgcgtgcgtct
gccctgcaggaagccctggagagagacaaagcggctggcctgattcctttctttatggtt
gccaccctggggaccacaacatgctgctcctttgacaatctcttagaagtcggtcctatc
tgcaacaaggaagacatatggctgcacgttgatgcagcctacgcaggcagtgcattcatc
tgccctgagttccggcaccttctgaatggagtggagtttgcagattcattcaactttaat
ccccacaaatggctattggtgaattttgactgttctgccatgtgggtgaaaaagagaaca
gacttaacgggagcctttagactggaccccacttacctgaagcacagccatcaggattca
gggcttatcactgactaccggcattggcagataccactgggcagaagatttcgctctttg
aaaatgtggtttgtatttaggatgtatggagtcaaaggactgcaggcttatatccgcaag
catgtccagctgtcccatgagtttgagtcactggtgcgccaggatccccgctttgaaatc
tgtgtggaagtcattctggggcttgtctgctttcggctaaagggttccaacaaagtgaat
gaagctcttctgcaaagaataaacagtgccaaaaaaatccacttggttccatgtcacctc
agggacaagtttgtcctgcgctttgccatctgttctcgcacggtggaatctgcccatgtg
cagcgggcctgggaacacatcaaagagctggcggccgacgtgctgcgagcagagagggag
tag

DBGET integrated database retrieval system