KEGG   Homo sapiens (human): 1644Help
Entry
1644              CDS       T01001                                 

Gene name
DDC, AADC
Definition
dopa decarboxylase (aromatic L-amino acid decarboxylase) (EC:4.1.1.28)
Orthology
K01593  
aromatic-L-amino-acid decarboxylase [EC:4.1.1.28]
Organism
hsa  Homo sapiens (human)
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
Melatonin biosynthesis, tryptophan => serotonin => melatonin
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Disease
H01161  
Aromatic L-amino acid decarboxylase (AADC) deficiency
Drug target
Methyldopa (levorotatory): 
Other: 
Class
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hsa00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:hsa00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:hsa00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hsa00380]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p12.2
AA seq 480 aa AA seqDB search
MNASEFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM
EKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMV
ATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN
EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaagtgaattccgaaggagagggaaggagatggtggattacgtggccaactac
atggaaggcattgagggacgccaggtctaccctgacgtggagcccgggtacctgcggccg
ctgatccctgccgctgcccctcaggagccagacacgtttgaggacatcatcaacgacgtt
gagaagataatcatgcctggggtgacgcactggcacagcccctacttcttcgcctacttc
cccactgccagctcgtacccggccatgcttgcggacatgctgtgcggggccattggctgc
atcggcttctcctgggcggcaagcccagcatgcacagagctggagactgtgatgatggac
tggctcgggaagatgctggaactaccaaaggcatttttgaatgagaaagctggagaaggg
ggaggagtgatccagggaagtgccagtgaagccaccctggtggccctgctggccgctcgg
accaaagtgatccatcggctgcaggcagcgtccccagagctcacacaggccgctatcatg
gagaagctggtggcttactcatccgatcaggcacactcctcagtggaaagagctgggtta
attggtggagtgaaattaaaagccatcccctcagatggcaacttcgccatgcgtgcgtct
gccctgcaggaagccctggagagagacaaagcggctggcctgattcctttctttatggtt
gccaccctggggaccacaacatgctgctcctttgacaatctcttagaagtcggtcctatc
tgcaacaaggaagacatatggctgcacgttgatgcagcctacgcaggcagtgcattcatc
tgccctgagttccggcaccttctgaatggagtggagtttgcagattcattcaactttaat
ccccacaaatggctattggtgaattttgactgttctgccatgtgggtgaaaaagagaaca
gacttaacgggagcctttagactggaccccacttacctgaagcacagccatcaggattca
gggcttatcactgactaccggcattggcagataccactgggcagaagatttcgctctttg
aaaatgtggtttgtatttaggatgtatggagtcaaaggactgcaggcttatatccgcaag
catgtccagctgtcccatgagtttgagtcactggtgcgccaggatccccgctttgaaatc
tgtgtggaagtcattctggggcttgtctgctttcggctaaagggttccaacaaagtgaat
gaagctcttctgcaaagaataaacagtgccaaaaaaatccacttggttccatgtcacctc
agggacaagtttgtcctgcgctttgccatctgttctcgcacggtggaatctgcccatgtg
cagcgggcctgggaacacatcaaagagctggcggccgacgtgctgcgagcagagagggag
tag

DBGET integrated database retrieval system