KEGG   Homo sapiens (human): 1647Help
Entry
1647              CDS       T01001                                 

Gene name
GADD45A, DDIT1, GADD45
Definition
(RefSeq) growth arrest and DNA damage inducible alpha
  KO
K04402  
growth arrest and DNA-damage-inducible protein
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    1647 (GADD45A)
   04068 FoxO signaling pathway
    1647 (GADD45A)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1647 (GADD45A)
   04210 Apoptosis
    1647 (GADD45A)
   04115 p53 signaling pathway
    1647 (GADD45A)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     1647 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     1647 (GADD45A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p31.2
AA seq 165 aa AA seqDB search
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctggaggaagtgctcagcaaagccctgagtcagcgcacgatcactgtcggggtg
tacgaagcggccaagctgctcaacgtcgaccccgataacgtggtgttgtgcctgctggcg
gcggacgaggacgacgacagagatgtggctctgcagatccacttcaccctgatccaggcg
ttttgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggccggctggcggag
ctcctgctcttggagaccgacgctggccccgcggcgagcgagggcgccgagcagcccccg
gacctgcactgcgtgctggtgacgaatccacattcatctcaatggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcaatgggttccagtgatt
aatctccctgaacggtga

DBGET integrated database retrieval system