KEGG   Homo sapiens (human): 1649Help
Entry
1649              CDS       T01001                                 

Gene name
DDIT3, CEBPZ, CHOP, CHOP-10, CHOP10, GADD153
Definition
(RefSeq) DNA damage inducible transcript 3
  KO
K04452  
DNA damage-inducible transcript 3
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Transcriptional misregulation in cancer
Disease
H00049  
Myxoid liposarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1649 (DDIT3)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    1649 (DDIT3)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    1649 (DDIT3)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    1649 (DDIT3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1649 (DDIT3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    1649 (DDIT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.1-q13.2
AA seq 169 aa AA seqDB search
MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASL
AWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRM
KEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgagtcattgcctttctccttcgggacactgtccagctgggagctggaagcc
tggtatgaggacctgcaagaggtcctgtcttcagatgaaaatgggggtacctatgtttca
cctcctggaaatgaagaggaagaatcaaaaatcttcaccactcttgaccctgcttctctg
gcttggctgactgaggaggagccagaaccagcagaggtcacaagcacctcccagagccct
cactctccagattccagtcagagctccctggctcaggaggaagaggaggaagaccaaggg
agaaccaggaaacggaaacagagtggtcattccccagcccgggctggaaagcagcgcatg
aaggagaaagaacaggagaatgaaaggaaagtggcacagctagctgaagagaatgaacgg
ctcaagcaggaaatcgagcgcctgaccagggaagtagaggcgactcgccgagctctgatt
gaccgaatggtgaatctgcaccaagcatga

DBGET integrated database retrieval system