KEGG   Homo sapiens (human): 1654Help
Entry
1654              CDS       T01001                                 

Gene name
DDX3X, DBX, DDX14, DDX3, HLP2
Definition
DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked (EC:3.6.4.13)
Orthology
K11594  
ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Hepatitis B
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    1654 (DDX3X)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1654 (DDX3X)
  Infectious diseases
   05161 Hepatitis B
    1654 (DDX3X)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     1654 (DDX3X)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    1654 (DDX3X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.3-p11.23
AA seq 661 aa AA seqDB search
MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGW
SSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFE
RGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIE
SFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILS
QIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVV
YGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQ
IRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV
WVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDR
EEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGL
ATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSRFSGGFGARD
YRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWG
N
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatgtggcagtggaaaatgcgctcgggctggaccagcagtttgctggcctagac
ctgaactcttcagataatcagagtggaggaagtacagccagcaaagggcgctatattcct
cctcatttaaggaaccgagaagctactaaaggtttctacgataaagacagttcagggtgg
agttctagcaaagataaggatgcgtatagcagttttggatctcgtagtgattcaagaggg
aagtctagcttcttcagtgatcgtggaagtggatcaaggggaaggtttgatgatcgtgga
cggagtgattacgatggcattggcagccgtggtgacagaagtggctttggcaaatttgaa
cgtggtggaaacagtcgctggtgtgacaaatcagatgaagatgattggtcaaaaccactc
ccaccaagtgaacgcttggaacaggaactcttttctggaggcaacactgggattaatttt
gagaaatacgatgacattccagttgaggcaacaggcaacaactgtcctccacatattgaa
agtttcagtgatgttgagatgggagaaattatcatgggaaacattgagcttactcgttat
actcgcccaactccagtgcaaaagcatgctattcctattatcaaagagaaaagagacttg
atggcttgtgcccaaacagggtctggaaaaactgcagcatttctgttgcccatcttgagt
cagatttattcagatggtccaggcgaggctttgagggccatgaaggaaaatggaaggtat
gggcgccgcaaacaatacccaatctccttggtattagcaccaacgagagagttggcagta
cagatctacgaggaagccagaaaattttcataccgatctagagttcgtccttgcgtggtt
tatggtggtgccgatattggtcagcagattcgagacttggaacgtggatgccatttgtta
gtagccactccaggacgtctagtggatatgatggaaagaggaaagattggattagacttt
tgcaaatacttggtgttagatgaagctgatcggatgttggatatggggtttgagcctcag
attcgtagaatagtcgaacaagatactatgcctccaaagggtgtccgccacactatgatg
tttagtgctacttttcctaaggaaatacagatgctggctcgtgatttcttagatgaatat
atcttcttggctgtaggaagagttggctctacctctgaaaacatcacacagaaagtagtt
tgggtggaagaatcagacaaacggtcatttctgcttgacctcctaaatgcaacaggcaag
gattcactgaccttagtgtttgtggagaccaaaaagggtgcagattctctggaggatttc
ttataccatgaaggatacgcatgtaccagcatccatggagaccgttctcagagggataga
gaagaggcccttcaccagttccgctcaggaaaaagcccaattttagtggctacagcagta
gcagcaagaggactggacatttcaaatgtgaaacatgttatcaattttgacttgccaagt
gatattgaagaatatgtacatcgtattggtcgtacgggacgtgtaggaaaccttggcctg
gcaacctcattctttaacgagaggaacataaatattactaaggatttgttggatcttctt
gttgaagctaaacaagaagtgccgtcttggttagaaaacatggcttatgaacaccactac
aagggtagcagtcgtggacgttctaagagcagatttagtggagggtttggtgccagagac
taccgacaaagtagcggtgccagcagttccagcttcagcagcagccgcgcaagcagcagc
cgcagtggcggaggtggccacggtagcagcagaggatttggtggaggtggctatggaggc
ttttacaacagtgatggatatggaggaaattataactcccagggggttgactggtggggt
aactga

DBGET integrated database retrieval system