KEGG   Homo sapiens (human): 1655Help
Entry
1655              CDS       T01001                                 

Gene name
DDX5, G17P1, HLR1, HUMP68, p68
Definition
DEAD (Asp-Glu-Ala-Asp) box helicase 5 (EC:3.6.4.13)
Orthology
K12823  
ATP-dependent RNA helicase DDX5/DBP2 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Transcriptional misregulation in cancer
Proteoglycans in cancer
Disease
H00024  
Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    1655 (DDX5)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    1655 (DDX5)
   05205 Proteoglycans in cancer
    1655 (DDX5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     1655 (DDX5)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    1655 (DDX5)
 Complex B
    1655 (DDX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21
AA seq 614 aa AA seqDB search
MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQ
EHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAI
QAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELA
QQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLR
RTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHI
NIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRK
MRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPN
SSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGS
GRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANY
TNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAA
APMIGYPMPTGYSQ
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggttattcgagtgaccgagaccgcggccgggaccgagggtttggtgcacctcga
tttggaggaagtagggcagggcccttatctggaaagaagtttggaaaccctggggagaaa
ttagttaaaaagaagtggaatcttgatgagctgcctaaatttgagaagaatttttatcaa
gagcaccctgatttggctaggcgcacagcacaagaggtggaaacatacagaagaagcaag
gaaattacagttagaggtcacaactgcccgaagccagttctaaatttttatgaagccaat
ttccctgcaaatgtcatggatgttattgcaagacagaatttcactgaacccactgctatt
caagctcagggatggccagttgctctaagtggattggatatggttggagtggcacagact
ggatctgggaaaacattgtcttatttgcttcctgccattgtccacatcaatcatcagcca
ttcctagagagaggcgatgggcctatttgtttggtgctggcaccaactcgggaactggcc
caacaggtgcagcaagtagctgctgaatattgtagagcatgtcgcttgaagtctacttgt
atctacggtggtgctcctaagggaccacaaatacgtgatttggagagaggtgtggaaatc
tgtattgcaacacctggaagactgattgactttttagagtgtggaaaaaccaatctgaga
agaacaacctaccttgtccttgatgaagcagatagaatgcttgatatgggctttgaaccc
caaataaggaagattgtggatcaaataagacctgataggcaaactctaatgtggagtgcg
acttggccaaaagaagtaagacagcttgctgaagatttcctgaaagactatattcatata
aacattggtgcacttgaactgagtgcaaaccacaacattcttcagattgtggatgtgtgt
catgacgtagaaaaggatgaaaaacttattcgtctaatggaagagatcatgagtgagaag
gagaataaaaccattgtttttgtggaaaccaaaagaagatgtgatgagcttaccagaaaa
atgaggagagatgggtggcctgccatgggtatccatggtgacaagagtcaacaagagcgt
gactgggttctaaatgaattcaaacatggaaaagctcctattctgattgctacagatgtg
gcctccagagggctagatgtggaagatgtgaaatttgtcatcaattatgactaccctaac
tcctcagaggattatattcatcgaattggaagaactgctcgcagtaccaaaacaggcaca
gcatacactttctttacacctaataacataaagcaagtgagcgaccttatctctgtgctt
cgtgaagctaatcaagcaattaatcccaagttgcttcagttggtcgaagacagaggttca
ggtcgttccaggggtagaggaggcatgaaggatgaccgtcgggacagatactctgcgggc
aaaaggggtggatttaatacctttagagacagggaaaattatgacagaggttactctagc
ctgcttaaaagagattttggggcaaaaactcagaatggtgtttacagtgctgcaaattac
accaatgggagctttggaagtaattttgtgtctgctggtatacagaccagttttaggact
ggtaatccaacagggacttaccagaatggttatgatagcactcagcaatacggaagtaat
gttccaaatatgcacaatggtatgaaccaacaggcatatgcatatcctgctactgcagct
gcacctatgattggttatccaatgccaacaggatattcccaataa

DBGET integrated database retrieval system