KEGG   Homo sapiens (human): 1655Help
Entry
1655              CDS       T01001                                 

Gene name
DDX5, G17P1, HLR1, HUMP68, p68
Definition
(RefSeq) DEAD-box helicase 5
  KO
K12823  ATP-dependent RNA helicase DDX5/DBP2 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    1655 (DDX5)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    1655 (DDX5)
   05205 Proteoglycans in cancer
    1655 (DDX5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     1655 (DDX5)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    1655 (DDX5)
 Complex B
    1655 (DDX5)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Helicases
    1655 (DDX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD P68HR Helicase_C ResIII ERCC3_RAD25_C Helicase_C_2
Motif
Other DBs
NCBI-GeneID: 1655
NCBI-ProteinID: NP_001307524
OMIM: 180630
HGNC: 2746
Ensembl: ENSG00000108654
Vega: OTTHUMG00000178936
Pharos: P17844(Tbio)
UniProt: P17844
Structure
PDB: 

Jmol
Position
17q23.3
AA seq 614 aa AA seqDB search
MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQ
EHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAI
QAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELA
QQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLR
RTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHI
NIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRK
MRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPN
SSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGS
GRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANY
TNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAA
APMIGYPMPTGYSQ
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggttattcgagtgaccgagaccgcggccgggaccgagggtttggtgcacctcga
tttggaggaagtagggcagggcccttatctggaaagaagtttggaaaccctggggagaaa
ttagttaaaaagaagtggaatcttgatgagctgcctaaatttgagaagaatttttatcaa
gagcaccctgatttggctaggcgcacagcacaagaggtggaaacatacagaagaagcaag
gaaattacagttagaggtcacaactgcccgaagccagttctaaatttttatgaagccaat
ttccctgcaaatgtcatggatgttattgcaagacagaatttcactgaacccactgctatt
caagctcagggatggccagttgctctaagtggattggatatggttggagtggcacagact
ggatctgggaaaacattgtcttatttgcttcctgccattgtccacatcaatcatcagcca
ttcctagagagaggcgatgggcctatttgtttggtgctggcaccaactcgggaactggcc
caacaggtgcagcaagtagctgctgaatattgtagagcatgtcgcttgaagtctacttgt
atctacggtggtgctcctaagggaccacaaatacgtgatttggagagaggtgtggaaatc
tgtattgcaacacctggaagactgattgactttttagagtgtggaaaaaccaatctgaga
agaacaacctaccttgtccttgatgaagcagatagaatgcttgatatgggctttgaaccc
caaataaggaagattgtggatcaaataagacctgataggcaaactctaatgtggagtgcg
acttggccaaaagaagtaagacagcttgctgaagatttcctgaaagactatattcatata
aacattggtgcacttgaactgagtgcaaaccacaacattcttcagattgtggatgtgtgt
catgacgtagaaaaggatgaaaaacttattcgtctaatggaagagatcatgagtgagaag
gagaataaaaccattgtttttgtggaaaccaaaagaagatgtgatgagcttaccagaaaa
atgaggagagatgggtggcctgccatgggtatccatggtgacaagagtcaacaagagcgt
gactgggttctaaatgaattcaaacatggaaaagctcctattctgattgctacagatgtg
gcctccagagggctagatgtggaagatgtgaaatttgtcatcaattatgactaccctaac
tcctcagaggattatattcatcgaattggaagaactgctcgcagtaccaaaacaggcaca
gcatacactttctttacacctaataacataaagcaagtgagcgaccttatctctgtgctt
cgtgaagctaatcaagcaattaatcccaagttgcttcagttggtcgaagacagaggttca
ggtcgttccaggggtagaggaggcatgaaggatgaccgtcgggacagatactctgcgggc
aaaaggggtggatttaatacctttagagacagggaaaattatgacagaggttactctagc
ctgcttaaaagagattttggggcaaaaactcagaatggtgtttacagtgctgcaaattac
accaatgggagctttggaagtaattttgtgtctgctggtatacagaccagttttaggact
ggtaatccaacagggacttaccagaatggttatgatagcactcagcaatacggaagtaat
gttccaaatatgcacaatggtatgaaccaacaggcatatgcatatcctgctactgcagct
gcacctatgattggttatccaatgccaacaggatattcccaataa

DBGET integrated database retrieval system