KEGG   Homo sapiens (human): 1676Help
Entry
1676              CDS       T01001                                 

Gene name
DFFA, DFF-45, DFF1, ICAD
Definition
DNA fragmentation factor, 45kDa, alpha polypeptide
Orthology
K02310  
DNA fragmentation factor, 45 kD, alpha subunit
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    1676 (DFFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.3-p36.2
AA seq 331 aa AA seqDB search
MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVT
LVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGA
GLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLD
QREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASH
ILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQT
QSLHSLRSISASKASPPGDLQNPKRARQDPT
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaccggggacgccggggtaccagaatctggcgagatccggactctaaagccg
tgtctgctgcgccgcaactacagccgcgaacagcacggcgtggccgcctcctgcctcgaa
gacctgaggagcaaggcctgtgacattctggccattgataagtccctgacaccagtcacc
ctggtcctggcagaggatggcaccatagtggatgatgacgattactttctgtgtctacct
tccaatactaagtttgtggcattggctagtaatgagaaatgggcatacaacaattcagat
ggaggtacagcttggatttcccaagagtcctttgatgtagatgaaacagacagcggggca
gggttgaagtggaagaatgtggccaggcagctgaaagaagatctgtccagcatcatcctc
ctatcagaggaggacctccagatgcttgttgacgctccctgctcagacctggctcaggaa
ctacgtcagagttgtgccaccgtccagcggctgcagcacacactccaacaggtgcttgac
caaagagaggaagtgcgtcagtccaagcagctcctgcagctgtacctccaggctttggag
aaagagggcagcctcttgtcaaagcaggaagagtccaaagctgcctttggtgaggaggtg
gatgcagtagacacgggtatcagcagagagacctcctcggacgttgcgctggcgagccac
atccttactgcactgagggagaagcaggctccagagctgagcttatctagtcaggatttg
gagttggttaccaaggaagaccccaaagcactggctgttgccttgaactgggacataaag
aagacggagactgttcaggaggcctgtgagcgggagctcgccctgcgcctgcagcagacg
cagagcttgcattctctccggagcatctcagcaagcaaggcctcaccacctggtgacctg
cagaatcctaagcgagccagacaggatcccacatag

DBGET integrated database retrieval system