KEGG   Homo sapiens (human): 1677Help
Entry
1677              CDS       T01001                                 

Gene name
DFFB, CAD, CPAN, DFF-40, DFF2, DFF40
Definition
(RefSeq) DNA fragmentation factor subunit beta
  KO
K02311  
DNA fragmentation factor, 40 kD, beta subunit [EC:3.-.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    1677 (DFFB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     1677 (DFFB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O76075(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.32
AA seq 338 aa AA seqDB search
MLQKPKSVKLRALRSPRKFGVAGRSCQEVLRKGCLRFQLPERGSRLCLYEDGTELTEDYF
PSVPDNAELVLLTLGQAWQGYVSDIRRFLSAFHEPQVGLIQAAQQLLCDEQAPQRQRLLA
DLLHNVSQNIAAETRAEDPPWFEGLESRFQSKSGYLRYSCESRIRSYLREVSSYPSTVGA
EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHS
INPYSNRESRILFSTWNLDHIIEKKRTIIPTLVEAIKEQDGREVDWEYFYGLLFTSENLK
LVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRKRQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctccagaagcccaagagcgtgaagctgcgggccctgcgcagcccgaggaagttcggc
gtggctggccggagctgccaggaggtgctgcgcaagggctgtctccgcttccagctccct
gagcgcggttcccggctgtgcctgtacgaggatggcacggagctgacggaagattacttc
cccagtgttcccgacaacgccgagctggtgctgctcaccttgggccaggcctggcagggc
tatgtgagcgacatcaggcgcttcctcagtgcatttcacgagccacaggtggggctcatc
caggccgcccagcagctgctgtgtgatgagcaggccccacagaggcagaggctgctggct
gacctcctgcacaacgtcagccagaacatcgcggccgagacccgggctgaggacccgccg
tggtttgaaggcttggagtcccgatttcagagcaagtctggctatctgagatacagctgt
gagagccggatccggagttacctgagggaggtgagctcctacccctccacggtgggtgcg
gaggctcaggaggaattcctgcgggtcctcggctccatgtgccagaggctccggtccatg
cagtacaatggcagctacttcgacagaggagccaagggcggcagccgcctctgcacaccg
gaaggctggttctcctgccagggtccctttgacatggacagctgcttatcaagacactcc
atcaacccctacagtaacagggagagcaggatcctcttcagcacctggaacctggatcac
ataatagaaaagaaacgcaccatcattcctacactggtggaagcaattaaggaacaagat
ggaagagaagtggactgggagtatttttatggcctgctttttacctcagagaacctaaaa
ctagtgcacattgtctgccataagaaaaccacccacaagctcaactgtgacccaagcaga
atctacaaaccccagacaaggttgaagcggaagcagcctgtgcggaaacgccagtga

DBGET integrated database retrieval system