KEGG   Homo sapiens (human): 1677Help
Entry
1677              CDS       T01001                                 

Gene name
DFFB, CAD, CPAN, DFF-40, DFF2, DFF40
Definition
DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase)
Orthology
K02311  
DNA fragmentation factor, 40 kD, beta subunit [EC:3.-.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Class
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.3
AA seq 362 aa AA seqDB search
MLQKPKSVKLRALRSPRKFGVAGRSCQEVLRKGCLRFQLPERGSRLCLYEDGTELTEDYF
PSVPDNAELVLLTLGQAWQGCEWQGLWRMCLLLDRHLLFVPLVADVSDIRRFLSAFHEPQ
VGLIQAAQQLLCDEQAPQRQRLLADLLHNVSQNIAAETRAEDPPWFEGLESRFQSKSGYL
RYSCESRIRSYLREVSSYPSTVGAEAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSR
LCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWNLDHIIEKKRTIIPTLVEAI
KEQDGREVDWEYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK
RQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgctccagaagcccaagagcgtgaagctgcgggccctgcgcagcccgaggaagttcggc
gtggctggccggagctgccaggaggtgctgcgcaagggctgtctccgcttccagctccct
gagcgcggttcccggctgtgcctgtacgaggatggcacggagctgacggaagattacttc
cccagtgttcccgacaacgccgagctggtgctgctcaccttgggccaggcctggcagggc
tgtgagtggcaaggactttggaggatgtgtcttctgctggaccggcaccttttgtttgtc
ccattggtggcagatgtgagcgacatcaggcgcttcctcagtgcatttcacgagccacag
gtggggctcatccaggccgcccagcagctgctgtgtgatgagcaggccccacagaggcag
aggctgctggctgacctcctgcacaacgtcagccagaacatcgcggccgagacccgggct
gaggacccgccgtggtttgaaggcttggagtcccgatttcagagcaagtctggctatctg
agatacagctgtgagagccggatccggagttacctgagggaggtgagctcctacccctcc
acggtgggtgcggaggctcaggaggaattcctgcgggtcctcggctccatgtgccagagg
ctccggtccatgcagtacaatggcagctacttcgacagaggagccaagggcggcagccgc
ctctgcacaccggaaggctggttctcctgccagggtccctttgacatggacagctgctta
tcaagacactccatcaacccctacagtaacagggagagcaggatcctcttcagcacctgg
aacctggatcacataatagaaaagaaacgcaccatcattcctacactggtggaagcaatt
aaggaacaagatggaagagaagtggactgggagtatttttatggcctgctttttacctca
gagaacctaaaactagtgcacattgtctgccataagaaaaccacccacaagctcaactgt
gacccaagcagaatctacaaaccccagacaaggttgaagcggaagcagcctgtgcggaaa
cgccagtga

DBGET integrated database retrieval system