KEGG   Homo sapiens (human): 1755Help
Entry
1755              CDS       T01001                                 

Gene name
DMBT1, GP340, muclin
Definition
deleted in malignant brain tumors 1
Orthology
K13912  
deleted in malignant brain tumors 1 protein
Organism
hsa  Homo sapiens (human)
Pathway
Salivary secretion
Class
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q26.13
AA seq 1785 aa AA seqDB search
MGISTVILEMCLLWGQVLSTGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTV
AEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYR
GSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWS
CPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRISPPVPTEGSESSLALRLVNGG
DRCRGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDD
VRCSGHESYLWSCPHNGWLTHNCGHSEDAGVICSAPQSRPTPSPDTWPTSHASTAGPESS
LALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQ
GSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPSPDTLPTIT
LPASTVGSESSLALRLVNGGDRCQGRVEVLYQGSWGTVCDDSWDTNDANVVCRQLGCGWA
MSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHSEDAGVICSASQSRP
TPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVV
CRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGV
ICSASQSQPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDY
WDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHN
CGHHEDAGVICSASQSQPTPSPDTWPTSRASTAGSESTLALRLVNGGDRCRGRVEVLYQG
SWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDDVRCSGHESYLWSC
PHNGWLSHNCGHHEDAGVICSAAQSQSTPRPDTWLTTNLPALTVGSESSLALRLVNGGDR
CRGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVR
CSGNESYLWSCPHKGWLTHNCGHHEDAGVICSATQINSTTTDWWHPTTTTTARPSSNCGG
FLFYASGTFSSPSYPAYYPNNAKCVWEIEVNSGYRINLGFSNLKLEAHHNCSFDYVEIFD
GSLNSSLLLGKICNDTRQIFTSSYNRMTIHFRSDISFQNTGFLAWYNSFPSDATLRLVNL
NSSYGLCAGRVEIYHGGTWGTVCDDSWTIQEAEVVCRQLGCGRAVSALGNAYFGSGSGPI
TLDDVECSGTESTLWQCRNRGWFSHNCNHREDAGVICSGNHLSTPAPFLNITRPNTDYSC
GGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEVQNNYRVTVIFRDVQLEGGCNYDYIEVFD
GPYRSSPLIARVCDGARGSFTSSSNFMSIRFISDHSITRRGFRAEYYSSPSNDSTNLLCL
PNHMQASVSRSYLQSLGFSASDLVISTWNGYYECRPQITPNLVIFTIPYSGCGTFKQADN
DTIDYSNFLTAAVSGGIIKRRTDLRIHVSCRMLQNTWVDTMYIANDTIHVANNTIQVEEV
QYGNFDVNISFYTSSSFLYPVTSRPYYVDLNQDLYVQAEILHSDAVLTLFVDTCVASPYS
NDFTSLTYDLIRSGCVRDDTYGPYSSPSLRIARFRFRAFHFLNRFPSVYLRCKMVVCRAY
DPSSRCYRGCVLRSKRDVGSYQEKVDVVLGPIQLQTPPRREEEPR
NT seq 5358 nt NT seq  +upstreamnt  +downstreamnt
atggggatctccacagtcatccttgaaatgtgtcttttatggggacaagttctatctaca
ggtgggtggatcccaaggactacagactacgcttcactgattccctcggaggtgcccttg
gatccaactgtagcagaaggttctccatttccctcggagtcgaccctggagtcaactgta
gcagaaggttctccgatttccttggagtcaaccctggagtcaaccgtagcagaaggttct
ctgattccctcagagtcaaccctggagtcaactgtagcagaaggatctgattctggtttg
gccctgaggctggtgaatggagatggcaggtgtcagggccgagtggagatcctataccga
ggctcctggggcaccgtgtgtgatgacagctgggacaccaatgatgccaacgtggtctgt
aggcagctgggttgtggctgggccatgtcagctccaggaaatgcctggtttggccagggc
tcaggacccattgccctggatgatgtgcgctgctcaggacacgaatcctacctgtggagc
tgcccccacaatggctggctctcccataactgtggccatggtgaagatgctggtgttatc
tgctcagctgcccagcctcagtcaacactcaggccagaaagttggcctgtcaggatatca
ccacctgtacccacagaaggatctgaatccagtttggccctgaggctggtgaatggaggc
gacaggtgtcgaggccgagtggaggtcctataccgaggctcctggggcaccgtgtgtgat
gactactgggacaccaatgatgccaatgtggtctgcaggcagctgggctgtggctgggcc
atgtcagccccaggaaatgcccagtttggccagggctcaggacccattgtcctggatgat
gtgcgctgctcaggacatgagtcctacctgtggagctgcccccacaatggctggctcacc
cacaactgtggccatagtgaagacgctggtgtcatctgctcagctccccagtcccggccg
acacccagcccagatacttggccgacctcacatgcatcaacagcaggacctgaatccagt
ttggccctgaggctggtgaatggaggtgacaggtgtcagggccgagtggaggtcctatac
cgaggctcctggggcaccgtgtgtgatgatagctgggacaccagtgacgccaatgtggtc
tgccggcagctgggctgtggctgggccacgtcagccccaggaaatgcccggtttggccag
ggttcaggacccattgtcctggatgacgtgcgctgctcaggctatgagtcctacctgtgg
agctgcccccacaatggctggctctcccataactgtcagcacagtgaagacgctggtgtc
atctgctcagctgcccactcctggtcgacgcccagtccagacacattgccgaccatcacc
ttgcctgcatcgacagtaggatctgaatccagtttggccctgaggctggtgaatggaggt
gacaggtgtcagggccgagtggaggtcctataccaaggctcctggggcaccgtgtgcgat
gacagctgggacaccaatgatgccaatgtcgtctgcaggcaactgggctgtggctgggcc
atgtcagccccaggaaatgcccggtttggtcagggctcaggacccattgtcctggatgat
gtgcgctgctcaggacacgagtcttacctgtggagctgcccccacaatggctggctctcc
cacaactgtggccatagtgaagacgctggtgtcatctgctcagcttcccagtcccggcca
acacctagtccagacacttggccaacctcacatgcatcaacagcaggatctgaatccagt
ttggccctgaggctggtgaatggaggtgacaggtgtcagggccgagtggaggtcctatac
cgaggctcctggggcaccgtgtgtgatgactactgggacaccaatgatgccaatgtggtt
tgcaggcagctgggctgtggctgggccatgtcagccccaggaaatgcccggtttggccag
ggttcaggacccattgtcctggatgatgtgcgctgctcaggacatgagtcctatctgtgg
agctgcccccacaatggctggctctcccacaactgtggccatcatgaagacgctggtgtc
atctgctcagcttcccagtcccagccgacacccagcccagacacttggccaacctcacat
gcatcaacagcaggatctgaatccagtttggccctgaggctggtgaatggaggtgacagg
tgtcagggccgagtggaggtcctataccgaggctcctggggcaccgtgtgtgatgactac
tgggacaccaatgatgccaatgtggtttgcaggcagctgggctgtggctgggccacgtca
gccccaggaaatgcccggtttggccagggttcaggacccattgtcctggatgatgtgcgc
tgctcaggacatgagtcctatctgtggagctgcccccacaatggctggctctcccacaac
tgtggccatcatgaagacgctggtgtcatctgctcagcttcccagtcccagccgacaccc
agcccagacacttggccaacctctcgtgcatcaacagcaggatctgaatccactttggcc
ctgagactggtgaatggaggtgacaggtgtcgaggccgagtggaggtcctataccaaggc
tcctggggcaccgtgtgtgatgactactgggacaccaatgatgccaacgtggtctgcagg
cagctgggctgtggctgggccatgtcagccccaggaaatgcccagtttggccagggctca
ggacccattgtcctggatgatgtgcgctgctcaggacacgagtcttacctgtggagctgc
ccccacaatggctggctctcccacaactgtggccatcatgaagatgctggtgtcatctgc
tcagctgctcagtcccagtcaacgcccaggccagatacttggctgaccaccaacttaccg
gcattgacagtaggatctgaatccagtttggctctgaggctggtgaatggaggtgacagg
tgtcgaggccgagtggaggtcctgtatcgaggctcctggggaaccgtgtgtgatgacagc
tgggacaccaatgatgccaatgtggtctgcaggcagctgggctgtggctgggccatgtcg
gccccaggaaatgcccggtttggccagggctcaggacccattgtcctggatgatgtgcgc
tgctcagggaatgagtcctacctgtggagctgcccccacaaaggctggctcacccacaac
tgtggccatcacgaagacgctggtgtcatctgctcagccacccaaataaattctactacg
acagattggtggcatccaacaactacaaccactgcaagaccctcttcaaattgtggtggc
ttcttattctatgccagtgggacattctccagcccatcctaccctgcatactaccccaac
aatgctaagtgtgtttgggaaatagaagtgaattctggttatcgcataaacctgggcttc
agtaatctgaaattggaggcacaccataactgcagttttgattatgttgaaatctttgat
ggatcattgaatagcagtctcctgctggggaaaatctgtaatgataccaggcaaatattt
acatcttcttacaaccgaatgaccattcactttcgaagtgacatcagtttccaaaacact
ggctttttggcttggtataactccttcccaagcgatgccaccttgaggttggtcaattta
aattcatcctatggtctatgtgccgggcgtgtagaaatttaccatggtggcacctggggg
acagtttgtgatgactcctggaccattcaggaagctgaggtggtctgcagacagctaggg
tgtggacgtgcagtttcagcccttggaaatgcatattttggctctggctctggccccatc
accctggacgatgtagagtgctcagggacggaatccactctctggcagtgccggaaccga
ggctggttctcccacaactgtaatcatcgtgaagatgctggtgtcatctgctcaggaaac
catctatcgacacctgctccttttctcaacatcacccgtccaaacacagattattcctgc
ggaggcttcctatcccaaccatcaggggacttttccagcccattctatcccgggaactat
ccaaacaatgccaagtgtgtgtgggacattgaggtgcaaaacaactaccgtgtgactgtg
atcttcagagatgtccagcttgaaggtggctgcaactatgattatattgaagttttcgat
ggcccctaccgcagttcccctctcattgctcgagtttgtgatggggccagaggctccttc
acttcttcctccaacttcatgtccattcgcttcatcagtgaccacagcatcacaaggaga
gggttccgggctgagtactactccagtccctccaatgacagcaccaacctgctctgtctg
ccaaatcacatgcaagccagtgtgagcaggagctatctccaatccttgggcttttctgcc
agtgaccttgtcatttccacctggaatggatactacgagtgtcggccccagataacgccg
aacctggtgatattcacaattccctactcaggctgcggcaccttcaagcaggcagacaat
gacaccatcgactattccaacttcctcacagcagctgtctcaggtggcatcatcaagagg
aggacagacctccgtattcacgtcagctgcagaatgcttcagaacacctgggtcgacacc
atgtacattgctaatgacaccatccacgttgctaataacaccatccaggtcgaggaagtc
cagtatggcaattttgacgtgaacatttccttttatacttcctcatctttcttgtatcct
gtgaccagccgcccttactacgtggacctgaaccaggacttgtacgttcaggctgaaatc
ctccattctgatgctgtactgaccttgtttgtggacacctgcgtggcatcaccatactcc
aatgacttcacgtctttgacttatgatctaatccggagtggatgcgtgagggatgacacc
tacggaccctactcctcgccatctcttcgcattgcccgcttccggttcagggccttccac
ttcctgaaccgcttcccctccgtgtacctgcgttgtaaaatggtggtgtgcagagcgtat
gacccctcttcccgctgctaccgaggctgtgtgttgaggtcgaagagggatgtgggctcc
taccaggaaaaggtggacgtcgtcctgggtcccatccagctgcagacccccccacgccga
gaagaggagcctcggtag

DBGET integrated database retrieval system