KEGG   Homo sapiens (human): 1755Help
Entry
1755              CDS       T01001                                 

Gene name
DMBT1, GP340, SAG, muclin
Definition
(RefSeq) deleted in malignant brain tumors 1
  KO
K13912  
deleted in malignant brain tumors 1 protein
Organism
hsa  Homo sapiens (human)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    1755 (DMBT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q26.13
AA seq 2413 aa AA seqDB search
MGISTVILEMCLLWGQVLSTGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTV
AEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYR
GSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWS
CPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRISPPVPTEGSESSLALRLVNGG
DRCRGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDD
VRCSGHESYLWSCPHNGWLTHNCGHSEDAGVICSAPQSRPTPSPDTWPTSHASTAGPESS
LALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQ
GSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPSPDTLPTIT
LPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWA
MLAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHNGWLSHNCGHSEDAGVICSGPESSL
ALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQG
SGPIVLDDVRCSGHESYLWSCPNNGWLSHNCGHHEDAGVICSAAQSRSTPRPDTLSTITL
PPSTVGSESSLTLRLVNGSDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAT
SAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSVSQSRPT
PSPDTWPTSHASTAGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVC
RQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVI
CSAAHSWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYQGSWGTVCDD
SWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSH
NCGHSEDAGVICSASQSRPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYR
GSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWS
CPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLALRLVNGGDRC
QGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRC
SGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLAL
RLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSG
PIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSRAST
AGSESTLALRLVNGGDRCRGRVEVLYQGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPG
NAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSAAQSQSTPRPD
TWLTTNLPALTVGSESSLALRLVNGGDRCRGRVEVLYRGSWGTVCDDSWDTNDANVVCRQ
LGCGWAMSAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHKGWLTHNCGHHEDAGVICS
ATQINSTTTDWWHPTTTTTARPSSNCGGFLFYASGTFSSPSYPAYYPNNAKCVWEIEVNS
GYRINLGFSNLKLEAHHNCSFDYVEIFDGSLNSSLLLGKICNDTRQIFTSSYNRMTIHFR
SDISFQNTGFLAWYNSFPSDATLRLVNLNSSYGLCAGRVEIYHGGTWGTVCDDSWTIQEA
EVVCRQLGCGRAVSALGNAYFGSGSGPITLDDVECSGTESTLWQCRNRGWFSHNCNHRED
AGVICSGNHLSTPAPFLNITRPNTDYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEV
QNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGARGSFTSSSNFMSIRFI
SDHSITRRGFRAEYYSSPSNDSTNLLCLPNHMQASVSRSYLQSLGFSASDLVISTWNGYY
ECRPQITPNLVIFTIPYSGCGTFKQADNDTIDYSNFLTAAVSGGIIKRRTDLRIHVSCRM
LQNTWVDTMYIANDTIHVANNTIQVEEVQYGNFDVNISFYTSSSFLYPVTSRPYYVDLNQ
DLYVQAEILHSDAVLTLFVDTCVASPYSNDFTSLTYDLIRSGCVRDDTYGPYSSPSLRIA
RFRFRAFHFLNRFPSVYLRCKMVVCRAYDPSSRCYRGCVLRSKRDVGSYQEKVDVVLGPI
QLQTPPRREEEPR
NT seq 7242 nt NT seq  +upstreamnt  +downstreamnt
atggggatctccacagtcatccttgaaatgtgtcttttatggggacaagttctatctaca
ggtgggtggatcccaaggactacagactacgcttcactgattccctcggaggtgcccttg
gatccaactgtagcagaaggttctccatttccctcggagtcgaccctggagtcaactgta
gcagaaggttctccgatttccttggagtcaaccctggagtcaaccgtagcagaaggttct
ctgattccctcagagtcaaccctggagtcaactgtagcagaaggatctgattctggtttg
gccctgaggctggtgaatggagatggcaggtgtcagggccgagtggagatcctataccga
ggctcctggggcaccgtgtgtgatgacagctgggacaccaatgatgccaacgtggtctgt
aggcagctgggttgtggctgggccatgtcagctccaggaaatgcctggtttggccagggc
tcaggacccattgccctggatgatgtgcgctgctcaggacacgaatcctacctgtggagc
tgcccccacaatggctggctctcccataactgtggccatggtgaagatgctggtgttatc
tgctcagctgcccagcctcagtcaacactcaggccagaaagttggcctgtcaggatatca
ccacctgtacccacagaaggatctgaatccagtttggccctgaggctggtgaatggaggc
gacaggtgtcgaggccgagtggaggtcctataccgaggctcctggggcaccgtgtgtgat
gactactgggacaccaatgatgccaatgtggtctgcaggcagctgggctgtggctgggcc
atgtcagccccaggaaatgcccagtttggccagggctcaggacccattgtcctggatgat
gtgcgctgctcaggacatgagtcctacctgtggagctgcccccacaatggctggctcacc
cacaactgtggccatagtgaagacgctggtgtcatctgctcagctccccagtcccggccg
acacccagcccagatacttggccgacctcacatgcatcaacagcaggacctgaatccagt
ttggccctgaggctggtgaatggaggtgacaggtgtcagggccgagtggaggtcctatac
cgaggctcctggggcaccgtgtgtgatgatagctgggacaccagtgacgccaatgtggtc
tgccggcagctgggctgtggctgggccacgtcagccccaggaaatgcccggtttggccag
ggttcaggacccattgtcctggatgacgtgcgctgctcaggctatgagtcctacctgtgg
agctgcccccacaatggctggctctcccataactgtcagcacagtgaagacgctggtgtc
atctgctcagctgcccactcctggtcgacgcccagtccagacacgttgccgaccatcacc
ttacctgcatcgacagtaggatctgaatccagtttggccctgaggctggtgaatggaggt
gacaggtgtcagggccgagtggaggtcctataccgaggctcctggggcaccgtgtgtgat
gacagctgggacaccaatgatgccaatgtggtctgcaggcagctgggctgtggctgggcc
atgttggccccaggaaatgcccggtttggtcagggctcaggacccattgtcctggatgac
gtgcgctgctcagggaatgagtcctacttgtggagctgcccccacaatggctggctctcc
cataactgtggccatagtgaagacgctggtgtcatctgctcaggacctgaatccagtttg
gccctgaggctggtgaatggaggtgacaggtgtcagggccgagtggaggtcctataccga
ggctcttggggcaccgtgtgtgatgacagctgggacaccaatgatgccaatgtggtctgc
aggcagctgggctgtggctgggccacgtcagccccaggaaatgcccggtttggtcagggc
tcaggacccattgtcctggatgatgtgcgctgctcaggacatgagtcctacctgtggagc
tgccccaacaatggctggctctcccacaactgtggccatcatgaagatgctggtgtcatc
tgctcagctgcccagtcccggtcgacgcccaggccagacacgttgtcgaccatcacgtta
cctccatcgacagtaggatctgaatccagtttgaccctgaggctggtgaatggaagtgac
aggtgtcagggccgagtagaggtcctataccgaggctcctggggcaccgtgtgtgatgac
agctgggataccaatgatgccaatgtggtctgcaggcagctgggctgtggctgggccacg
tcggccccaggaaatgcccggtttggccagggctcaggacccattgttctggatgatgtg
cgctgctcaggacacgagtcctacctgtggagctgcccccacaatggctggctctcccac
aactgtggccatcatgaagatgctggtgtcatctgctcagtttcccagtcccggccgaca
cccagtccagatacttggccgacctcacatgcatcaacagcaggacctgaatccagtttg
gccctgaggctggtgaatggaggtgacaggtgtcagggccgagtggaggtcctataccga
ggctcctggggcaccgtgtgtgatgatagctgggacaccagtgacgccaatgtggtctgc
cggcagctgggctgtggctgggccacgtcagccccaggaaatgcccggtttggccagggt
tcaggacccattgtcctggatgacgtgcgctgctcaggctatgagtcctacctgtggagc
tgcccccacaatggctggctctcccataactgtcagcacagtgaagacgctggtgtcatc
tgctcagctgcccactcctggtcgacgcccagtccagacacattgccgaccatcaccttg
cctgcatcgacagtaggatctgaatccagtttggccctgaggctggtgaatggaggtgac
aggtgtcagggccgagtggaggtcctataccaaggctcctggggcaccgtgtgcgatgac
agctgggacaccaatgatgccaatgtcgtctgcaggcaactgggctgtggctgggccatg
tcagccccaggaaatgcccggtttggtcagggctcaggacccattgtcctggatgatgtg
cgctgctcaggacacgagtcttacctgtggagctgcccccacaatggctggctctcccac
aactgtggccatagtgaagacgctggtgtcatctgctcagcttcccagtcccggccaaca
cctagtccagacacttggccaacctcacatgcatcaacagcaggatctgaatccagtttg
gccctgaggctggtgaatggaggtgacaggtgtcagggccgagtggaggtcctataccga
ggctcctggggcaccgtgtgtgatgactactgggacaccaatgatgccaatgtggtttgc
aggcagctgggctgtggctgggccatgtcagccccaggaaatgcccggtttggccagggt
tcaggacccattgtcctggatgatgtgcgctgctcaggacatgagtcctatctgtggagc
tgcccccacaatggctggctctcccacaactgtggccatcatgaagacgctggtgtcatc
tgctcagcttcccagtcccagccgacacccagcccagacacttggccaacctcacatgca
tcaacagcaggatctgaatccagtttggccctgaggctggtgaatggaggtgacaggtgt
cagggccgagtggaggtcctataccgaggctcctggggcaccgtgtgtgatgactactgg
gacaccaatgatgccaatgtggtttgcaggcagctgggctgtggctgggccacgtcagcc
ccaggaaatgcccggtttggccagggttcaggacccattgtcctggatgatgtgcgctgc
tcaggacatgagtcctatctgtggagctgcccccacaatggctggctctcccacaactgt
ggccatcatgaagacgctggtgtcatctgctcagcttcccagtcccagccgacacccagc
ccagacacttggccaacctcacatgcatcaacagcaggatctgaatccagtttggccctg
aggctggtgaatggaggtgacaggtgtcagggccgagtggaggtcctataccgaggctcc
tggggcaccgtgtgtgatgactactgggacaccaatgatgccaatgtggtttgcaggcag
ctgggctgtggctgggccacgtcagccccaggaaatgcccggtttggccagggttcagga
cccattgtcctggatgatgtgcgctgctcaggacatgagtcctatctgtggagctgcccc
cacaatggctggctctcccacaactgtggccatcatgaagacgctggtgtcatctgctca
gcttcccagtcccagccgacacccagcccagacacttggccaacctctcgtgcatcaaca
gcaggatctgaatccactttggccctgagactggtgaatggaggtgacaggtgtcgaggc
cgagtggaggtcctataccaaggctcctggggcaccgtgtgtgatgactactgggacacc
aatgatgccaacgtggtctgcaggcagctgggctgtggctgggccatgtcagccccagga
aatgcccagtttggccagggctcaggacccattgtcctggatgatgtgcgctgctcagga
cacgagtcttacctgtggagctgcccccacaatggctggctctcccacaactgtggccat
catgaagatgctggtgtcatctgctcagctgctcagtcccagtcaacgcccaggccagat
acttggctgaccaccaacttaccggcattgacagtaggatctgaatccagtttggctctg
aggctggtgaatggaggtgacaggtgtcgaggccgagtggaggtcctgtatcgaggctcc
tggggaaccgtgtgtgatgacagctgggacaccaatgatgccaatgtggtctgcaggcag
ctgggctgtggctgggccatgtcggccccaggaaatgcccggtttggccagggctcagga
cccattgtcctggatgatgtgcgctgctcagggaatgagtcctacctgtggagctgcccc
cacaaaggctggctcacccacaactgtggccatcacgaagacgctggtgtcatctgctca
gccacccaaataaattctactacgacagattggtggcatccaacaactacaaccactgca
agaccctcttcaaattgtggtggcttcttattctatgccagtgggacattctccagccca
tcctaccctgcatactaccccaacaatgctaagtgtgtttgggaaatagaagtgaattct
ggttatcgcataaacctgggcttcagtaatctgaaattggaggcacaccataactgcagt
tttgattatgttgaaatctttgatggatcattgaatagcagtctcctgctggggaaaatc
tgtaatgataccaggcaaatatttacatcttcttacaaccgaatgaccattcactttcga
agtgacatcagtttccaaaacactggctttttggcttggtataactccttcccaagcgat
gccaccttgaggttggtcaatttaaattcatcctatggtctatgtgccgggcgtgtagaa
atttaccatggtggcacctgggggacagtttgtgatgactcctggaccattcaggaagct
gaggtggtctgcagacagctagggtgtggacgtgcagtttcagcccttggaaatgcatat
tttggctctggctctggccccatcaccctggacgatgtagagtgctcagggacggaatcc
actctctggcagtgccggaaccgaggctggttctcccacaactgtaatcatcgtgaagat
gctggtgtcatctgctcaggaaaccatctatcgacacctgctccttttctcaacatcacc
cgtccaaacacagattattcctgcggaggcttcctatcccaaccatcaggggacttttcc
agcccattctatcccgggaactatccaaacaatgccaagtgtgtgtgggacattgaggtg
caaaacaactaccgtgtgactgtgatcttcagagatgtccagcttgaaggtggctgcaac
tatgattatattgaagttttcgatggcccctaccgcagttcccctctcattgctcgagtt
tgtgatggggccagaggctccttcacttcttcctccaacttcatgtccattcgcttcatc
agtgaccacagcatcacaaggagagggttccgggctgagtactactccagtccctccaat
gacagcaccaacctgctctgtctgccaaatcacatgcaagccagtgtgagcaggagctat
ctccaatccttgggcttttctgccagtgaccttgtcatttccacctggaatggatactac
gagtgtcggccccagataacgccgaacctggtgatattcacaattccctactcaggctgc
ggcaccttcaagcaggcagacaatgacaccatcgactattccaacttcctcacagcagct
gtctcaggtggcatcatcaagaggaggacagacctccgtattcacgtcagctgcagaatg
cttcagaacacctgggtcgacaccatgtacattgctaatgacaccatccacgttgctaat
aacaccatccaggtcgaggaagtccagtatggcaattttgacgtgaacatttccttttat
acttcctcatctttcttgtatcctgtgaccagccgcccttactacgtggacctgaaccag
gacttgtacgttcaggctgaaatcctccattctgatgctgtactgaccttgtttgtggac
acctgcgtggcatcaccatactccaatgacttcacgtctttgacttatgatctaatccgg
agtggatgcgtgagggatgacacctacggaccctactcctcgccatctcttcgcattgcc
cgcttccggttcagggccttccacttcctgaaccgcttcccctccgtgtacctgcgttgt
aaaatggtggtgtgcagagcgtatgacccctcttcccgctgctaccgaggctgtgtgttg
aggtcgaagagggatgtgggctcctaccaggaaaaggtggacgtcgtcctgggtcccatc
cagctgcagacccccccacgccgagaagaggagcctcggtag

DBGET integrated database retrieval system