KEGG   Homo sapiens (human): 1813Help
Entry
1813              CDS       T01001                                 

Gene name
DRD2, D2DR, D2R
Definition
dopamine receptor D2
Orthology
K04145  
dopamine receptor D2
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Dopaminergic synapse
Parkinson's disease
Cocaine addiction
Alcoholism
Drug target
Metoclopramide: 
Domperidone: 
Bromopride: 
Alizapride: 
Clebopride: 
Metopimazine: 
Dopamine: 
Dopexamine: 
Ibopamine: 
Methylergometrine: 
Ergot alkaloids: 
Ergometrine: 
Bromocriptine: 
Lisuride: 
Cabergoline: 
Quinagolide: 
Terguride: 
Apomorphine: 
Dihydroergotamine: 
Ergotamine: 
Levodopa: 
Pergolide: 
Dihydroergocryptine mesylate: 
Ropinirole: 
Pramipexole: 
Apomorphine: 
Piribedil: 
Rotigotine: 
Chlorpromazine: 
Levomepromazine: 
Promazine: 
Triflupromazine: 
Fluphenazine: 
Perphenazine: 
Prochlorperazine: 
Trifluoperazine: 
Thioproperazine: 
Perazine: 
Periciazine: 
Thioridazine: 
Haloperidol: 
Trifluperidol: 
Moperone: 
Pipamperone: 
Bromperidol: 
Droperidol: 
Molindone: 
Sertindole: 
Ziprasidone: 
Lurasidone: 
Flupentixol: 
Clopenthixol: 
Tiotixene: 
Zuclopenthixol: 
Pimozide: 
Loxapine: 
Clozapine: 
Olanzapine: 
Quetiapine: 
Asenapine: 
Sulpiride: 
Sultopride: 
Tiapride: 
Remoxipride: 
Levosulpiride: 
Risperidone: 
Mosapramine: 
Zotepine: 
Aripiprazole: 
Paliperidone: 
Iloperidone: 
Opipramol: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    1813 (DRD2)
   04024 cAMP signaling pathway
    1813 (DRD2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1813 (DRD2)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    1813 (DRD2)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    1813 (DRD2)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    1813 (DRD2)
  Substance dependence
   05030 Cocaine addiction
    1813 (DRD2)
   05034 Alcoholism
    1813 (DRD2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Dopamine [OT]
    1813 (DRD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q23
AA seq 443 aa AA seqDB search
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggatccactgaatctgtcctggtatgatgatgatctggagaggcagaactggagccgg
cccttcaacgggtcagacgggaaggcggacagaccccactacaactactatgccacactg
ctcaccctgctcatcgctgtcatcgtcttcggcaacgtgctggtgtgcatggctgtgtcc
cgcgagaaggcgctgcagaccaccaccaactacctgatcgtcagcctcgcagtggccgac
ctcctcgtcgccacactggtcatgccctgggttgtctacctggaggtggtaggtgagtgg
aaattcagcaggattcactgtgacatcttcgtcactctggacgtcatgatgtgcacggcg
agcatcctgaacttgtgtgccatcagcatcgacaggtacacagctgtggccatgcccatg
ctgtacaatacgcgctacagctccaagcgccgggtcaccgtcatgatctccatcgtctgg
gtcctgtccttcaccatctcctgcccactcctcttcggactcaataacgcagaccagaac
gagtgcatcattgccaacccggccttcgtggtctactcctccatcgtctccttctacgtg
cccttcattgtcaccctgctggtctacatcaagatctacattgtcctccgcagacgccgc
aagcgagtcaacaccaaacgcagcagccgagctttcagggcccacctgagggctccacta
aagggcaactgtactcaccccgaggacatgaaactctgcaccgttatcatgaagtctaat
gggagtttcccagtgaacaggcggagagtggaggctgcccggcgagcccaggagctggag
atggagatgctctccagcaccagcccacccgagaggacccggtacagccccatcccaccc
agccaccaccagctgactctccccgacccgtcccaccatggtctccacagcactcccgac
agccccgccaaaccagagaagaatgggcatgccaaagaccaccccaagattgccaagatc
tttgagatccagaccatgcccaatggcaaaacccggacctccctcaagaccatgagccgt
aggaagctctcccagcagaaggagaagaaagccactcagatgctcgccattgttctcggc
gtgttcatcatctgctggctgcccttcttcatcacacacatcctgaacatacactgtgac
tgcaacatcccgcctgtcctgtacagcgccttcacgtggctgggctatgtcaacagcgcc
gtgaaccccatcatctacaccaccttcaacattgagttccgcaaggccttcctgaagatc
ctccactgctga

DBGET integrated database retrieval system