KEGG   Homo sapiens (human): 1813Help
Entry
1813              CDS       T01001                                 

Gene name
DRD2, D2DR, D2R
Definition
dopamine receptor D2
Orthology
K04145  
dopamine receptor D2
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Dopaminergic synapse
Parkinson's disease
Cocaine addiction
Alcoholism
Drug target
Metoclopramide: 
Domperidone: 
Bromopride: 
Alizapride: 
Clebopride: 
Metopimazine: 
Dopamine: 
Dopexamine: 
Ibopamine: 
Methylergometrine: 
Ergot alkaloids: 
Ergometrine: 
Bromocriptine: 
Lisuride: 
Cabergoline: 
Quinagolide: 
Terguride: 
Apomorphine: 
Dihydroergotamine: 
Ergotamine: 
Levodopa: 
Pergolide: 
Ropinirole: 
Pramipexole: 
Apomorphine: 
Piribedil: 
Rotigotine: 
Chlorpromazine: 
Levomepromazine: 
Promazine: 
Triflupromazine: 
Fluphenazine: 
Perphenazine: 
Prochlorperazine: 
Trifluoperazine: 
Thioproperazine: 
Periciazine: 
Thioridazine: 
Haloperidol: 
Trifluperidol: 
Moperone: 
Pipamperone: 
Bromperidol: 
Droperidol: 
Molindone: 
Sertindole: 
Ziprasidone: 
Lurasidone: 
Flupentixol: 
Clopenthixol: 
Tiotixene: 
Zuclopenthixol: 
Pimozide: 
Loxapine: 
Clozapine: 
Olanzapine: 
Quetiapine: 
Asenapine: 
Sulpiride: 
Sultopride: 
Tiapride: 
Remoxipride: 
Levosulpiride: 
Risperidone: 
Mosapramine: 
Zotepine: 
Aripiprazole: 
Paliperidone: 
Iloperidone: 
Opipramol: 
Other: 
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q23
AA seq 443 aa AA seqDB search
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggatccactgaatctgtcctggtatgatgatgatctggagaggcagaactggagccgg
cccttcaacgggtcagacgggaaggcggacagaccccactacaactactatgccacactg
ctcaccctgctcatcgctgtcatcgtcttcggcaacgtgctggtgtgcatggctgtgtcc
cgcgagaaggcgctgcagaccaccaccaactacctgatcgtcagcctcgcagtggccgac
ctcctcgtcgccacactggtcatgccctgggttgtctacctggaggtggtaggtgagtgg
aaattcagcaggattcactgtgacatcttcgtcactctggacgtcatgatgtgcacggcg
agcatcctgaacttgtgtgccatcagcatcgacaggtacacagctgtggccatgcccatg
ctgtacaatacgcgctacagctccaagcgccgggtcaccgtcatgatctccatcgtctgg
gtcctgtccttcaccatctcctgcccactcctcttcggactcaataacgcagaccagaac
gagtgcatcattgccaacccggccttcgtggtctactcctccatcgtctccttctacgtg
cccttcattgtcaccctgctggtctacatcaagatctacattgtcctccgcagacgccgc
aagcgagtcaacaccaaacgcagcagccgagctttcagggcccacctgagggctccacta
aagggcaactgtactcaccccgaggacatgaaactctgcaccgttatcatgaagtctaat
gggagtttcccagtgaacaggcggagagtggaggctgcccggcgagcccaggagctggag
atggagatgctctccagcaccagcccacccgagaggacccggtacagccccatcccaccc
agccaccaccagctgactctccccgacccgtcccaccatggtctccacagcactcccgac
agccccgccaaaccagagaagaatgggcatgccaaagaccaccccaagattgccaagatc
tttgagatccagaccatgcccaatggcaaaacccggacctccctcaagaccatgagccgt
aggaagctctcccagcagaaggagaagaaagccactcagatgctcgccattgttctcggc
gtgttcatcatctgctggctgcccttcttcatcacacacatcctgaacatacactgtgac
tgcaacatcccgcctgtcctgtacagcgccttcacgtggctgggctatgtcaacagcgcc
gtgaaccccatcatctacaccaccttcaacattgagttccgcaaggccttcctgaagatc
ctccactgctga

DBGET integrated database retrieval system