KEGG   Homo sapiens (human): 183Help
Entry
183               CDS       T01001                                 

Gene name
AGT, ANHU, SERPINA8
Definition
angiotensinogen (serpin peptidase inhibitor, clade A, member 8)
Orthology
K09821  
angiotensinogen
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Disease
H00575  
Renal tubular dysgenesis
Class
Organismal Systems; Endocrine system; Renin-angiotensin system [PATH:hsa04614]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q42.2
AA seq 485 aa AA seqDB search
MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAG
KPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGM
HSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKV
LSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLD
FTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF
WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLT
FQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIR
VGEVLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVAN
PLSTA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcggaagcgagcaccccagtctgagatggctcctgccggtgtgagcctgagggccacc
atcctctgcctcctggcctgggctggcctggctgcaggtgaccgggtgtacatacacccc
ttccacctcgtcatccacaatgagagtacctgtgagcagctggcaaaggccaatgccggg
aagcccaaagaccccaccttcatacctgctccaattcaggccaagacatcccctgtggat
gaaaaggccctacaggaccagctggtgctagtcgctgcaaaacttgacaccgaagacaag
ttgagggccgcaatggtcgggatgctggccaacttcttgggcttccgtatatatggcatg
cacagtgagctatggggcgtggtccatggggccaccgtcctctccccaacggctgtcttt
ggcaccctggcctctctctatctgggagccttggaccacacagctgacaggctacaggca
atcctgggtgttccttggaaggacaagaactgcacctcccggctggatgcgcacaaggtc
ctgtctgccctgcaggctgtacagggcctgctagtggcccagggcagggctgatagccag
gcccagctgctgctgtccacggtggtgggcgtgttcacagccccaggcctgcacctgaag
cagccgtttgtgcagggcctggctctctatacccctgtggtcctcccacgctctctggac
ttcacagaactggatgttgctgctgagaagattgacaggttcatgcaggctgtgacagga
tggaagactggctgctccctgatgggagccagtgtggacagcaccctggctttcaacacc
tacgtccacttccaagggaagatgaagggcttctccctgctggccgagccccaggagttc
tgggtggacaacagcacctcagtgtctgttcccatgctctctggcatgggcaccttccag
cactggagtgacatccaggacaacttctcggtgactcaagtgcccttcactgagagcgcc
tgcctgctgctgatccagcctcactatgcctctgacctggacaaggtggagggtctcact
ttccagcaaaactccctcaactggatgaagaaactatctccccggaccatccacctgacc
atgccccaactggtgctgcaaggatcttatgacctgcaggacctgctcgcccaggctgag
ctgcccgccattctgcacaccgagctgaacctgcaaaaattgagcaatgaccgcatcagg
gtgggggaggtgctgaacagcattttttttgagcttgaagcggatgagagagagcccaca
gagtctacccaacagcttaacaagcctgaggtcttggaggtgaccctgaaccgcccattc
ctgtttgctgtgtatgatcaaagcgccactgccctgcacttcctgggccgcgtggccaac
ccgctgagcacagcatga

DBGET integrated database retrieval system