KEGG   Homo sapiens (human): 1869Help
Entry
1869              CDS       T01001                                 

Gene name
E2F1, E2F-1, RBAP1, RBBP3, RBP3
Definition
E2F transcription factor 1
Orthology
K17454  
transcription factor E2F1
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Hepatitis B
HTLV-I infection
Pathways in cancer
MicroRNAs in cancer
Pancreatic cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1869 (E2F1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1869 (E2F1)
   05206 MicroRNAs in cancer
    1869 (E2F1)
   05212 Pancreatic cancer
    1869 (E2F1)
   05214 Glioma
    1869 (E2F1)
   05220 Chronic myeloid leukemia
    1869 (E2F1)
   05218 Melanoma
    1869 (E2F1)
   05219 Bladder cancer
    1869 (E2F1)
   05215 Prostate cancer
    1869 (E2F1)
   05222 Small cell lung cancer
    1869 (E2F1)
   05223 Non-small cell lung cancer
    1869 (E2F1)
  Infectious diseases
   05166 HTLV-I infection
    1869 (E2F1)
   05161 Hepatitis B
    1869 (E2F1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    1869 (E2F1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.2
AA seq 437 aa AA seqDB search
MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE
ETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS
RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggccttggccggggcccctgcgggcggcccatgcgcgccggcgctggaggccctgctc
ggggccggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctccgccgcgcag
gacgccagcgccccgccggctcccaccggccccgcggcgcccgccgccggcccctgcgac
cctgacctgctgctcttcgccacaccgcaggcgccccggcccacacccagtgcgccgcgg
cccgcgctcggccgcccgccggtgaagcggaggctggacctggaaactgaccatcagtac
ctggccgagagcagtgggccagctcggggcagaggccgccatccaggaaaaggtgtgaaa
tccccgggggagaagtcacgctatgagacctcactgaatctgaccaccaagcgcttcctg
gagctgctgagccactcggctgacggtgtcgtcgacctgaactgggctgccgaggtgctg
aaggtgcagaagcggcgcatctatgacatcaccaacgtccttgagggcatccagctcatt
gccaagaagtccaagaaccacatccagtggctgggcagccacaccacagtgggcgtcggc
ggacggcttgaggggttgacccaggacctccgacagctgcaggagagcgagcagcagctg
gaccacctgatgaatatctgtactacgcagctgcgcctgctctccgaggacactgacagc
cagcgcctggcctacgtgacgtgtcaggaccttcgtagcattgcagaccctgcagagcag
atggttatggtgatcaaagcccctcctgagacccagctccaagccgtggactcttcggag
aactttcagatctcccttaagagcaaacaaggcccgatcgatgttttcctgtgccctgag
gagaccgtaggtgggatcagccctgggaagaccccatcccaggaggtcacttctgaggag
gagaacagggccactgactctgccaccatagtgtcaccaccaccatcatctcccccctca
tccctcaccacagatcccagccagtctctactcagcctggagcaagaaccgctgttgtcc
cggatgggcagcctgcgggctcccgtggacgaggaccgcctgtccccgctggtggcggcc
gactcgctcctggagcatgtgcgggaggacttctccggcctcctccctgaggagttcatc
agcctttccccaccccacgaggccctcgactaccacttcggcctcgaggagggcgagggc
atcagagacctcttcgactgtgactttggggacctcacccccctggatttctga

DBGET integrated database retrieval system