KEGG   Homo sapiens (human): 1889Help
Entry
1889              CDS       T01001                                 

Gene name
ECE1, ECE
Definition
(RefSeq) endothelin converting enzyme 1 (EC:3.4.24.71)
  KO
K01415  
endothelin-converting enzyme [EC:3.4.24.71]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.71  endothelin-converting enzyme 1
     1889 (ECE1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M13: neprilysin family
   1889 (ECE1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1889 (ECE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.1
AA seq 770 aa AA seqDB search
MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFHSPRSGQRCWA
ARTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMDPTVD
PCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQV
YYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQDTLQVVTAHYRTSPFFSVY
VSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGYLNYMVQLGKLLGGGDEEAI
RPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLPFLNTIFYPVE
INESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEV
MYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILEIKKAFEESLS
TLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNF
SWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGG
IGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKRQTECMVEQYSNYSVNGEPVN
GRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLFFLGFAQVWCSVRTP
ESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgcggggcgtgtggccgcccccggtgtccgccctgctgtcggcgctggggatgtcgacg
tacaagcgggccacgctggacgaggaggacctggtggactcgctctccgagggcgacgca
taccccaacggcctgcaggtgaacttccacagcccccggagtggccagaggtgctgggct
gcacggacccaggtggagaagcggctggtggtgttggtggtacttctggcggcaggactg
gtggcctgcttggcagcactgggcatccagtaccagacaagatccccctctgtgtgcctg
agcgaagcttgtgtctcagtgaccagctccatcttgagctccatggaccccacagtggac
ccctgccatgacttcttcagctacgcctgtgggggctggatcaaggccaacccagtccct
gatggccactcacgctgggggaccttcagcaacctctgggaacacaaccaagcaatcatc
aagcacctcctcgaaaactccacggccagcgtgagcgaggcagagagaaaggcgcaagta
tactaccgtgcgtgcatgaacgagaccaggatcgaggagctcagggccaaacctctaatg
gagttgattgagaggctcgggggctggaacatcacaggtccctgggccaaggacaacttc
caggacaccctgcaggtggtcaccgcccactaccgcacctcacccttcttctctgtctat
gtcagtgccgattccaagaactccaacagcaacgtgatccaggtggaccagtctggcctg
ggcttgccctcgagagactattacctgaacaaaactgaaaacgagaaggtgctgaccgga
tatctgaactacatggtccagctggggaagctgctgggcggcggggacgaggaggccatc
cggccccagatgcagcagatcttggactttgagacggcactggccaacatcaccatccca
caggagaagcgccgtgatgaggagctcatctaccacaaagtgacggcagccgagctgcag
accttggcacccgccatcaactggttgccttttctcaacaccatcttctaccccgtggag
atcaatgaatccgagcctattgtggtctatgacaaggaataccttgagcagatctccact
ctcatcaacaccaccgacagatgcctgctcaacaactacatgatctggaacctggtgcgg
aaaacaagctccttccttgaccagcgctttcaggacgccgatgagaagttcatggaagtc
atgtacgggaccaagaagacctgtcttcctcgctggaagttttgcgtgagtgacacagaa
aacaacctgggctttgcgttgggccccatgtttgtcaaagcaaccttcgccgaggacagc
aagagcatagccaccgagatcatcctggagattaagaaggcatttgaggaaagcctgagc
accctgaagtggatggatgaggaaacccgaaaatcagccaaggaaaaggccgatgccatc
tacaacatgataggataccccaacttcatcatggatcccaaggagctggacaaagtgttt
aatgactacactgcagttccagacctctactttgaaaatgccatgcggtttttcaacttc
tcatggagggtcactgccgatcagctcaggaaagcccccaacagagatcagtggagcatg
accccgcccatggtgaacgcctactactcgcccaccaagaatgagattgtgtttccggcc
gggatcctgcaggcaccattctacacacgctcctcacccaaggccttaaactttggtggc
ataggtgtcgtcgtgggccatgagctgactcatgcttttgatgatcaaggacgggagtat
gacaaggacgggaacctccggccatggtggaagaactcatccgtggaggccttcaagcgt
cagaccgagtgcatggtagagcagtacagcaactacagcgtgaacggggagccggtgaac
gggcggcacaccctgggggagaacatcgccgacaacgggggtctcaaggcggcctatcgg
gcttaccagaactgggtgaagaagaacggggctgagcactcgctccccaccctgggcctc
accaataaccagctcttcttcctgggctttgcacaggtctggtgctccgtccgcacacct
gagagctcccacgaaggcctcatcaccgatccccacagcccctctcgcttccgggtcatc
ggctccctctccaattccaaggagttctcagaacacttccgctgcccacctggctcaccc
atgaacccgcctcacaagtgcgaagtctggtaa

DBGET integrated database retrieval system