KEGG   Homo sapiens (human): 1892Help
Entry
1892              CDS       T01001                                 

Gene name
ECHS1, ECHS1D, SCEH
Definition
(RefSeq) enoyl-CoA hydratase, short chain 1
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00062  Fatty acid elongation
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa00310  Lysine degradation
hsa00380  Tryptophan metabolism
hsa00410  beta-Alanine metabolism
hsa00640  Propanoate metabolism
hsa00650  Butanoate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01212  Fatty acid metabolism
Module
hsa_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
hsa_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
hsa_M00085  Fatty acid biosynthesis, elongation, mitochondria
hsa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    1892 (ECHS1)
   00650 Butanoate metabolism
    1892 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    1892 (ECHS1)
   00071 Fatty acid degradation
    1892 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    1892 (ECHS1)
   00310 Lysine degradation
    1892 (ECHS1)
   00380 Tryptophan metabolism
    1892 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    1892 (ECHS1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     1892 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 1892
NCBI-ProteinID: NP_004083
OMIM: 602292
HGNC: 3151
Ensembl: ENSG00000127884
Vega: OTTHUMG00000019320
Pharos: P30084(Tbio)
UniProt: P30084
Structure
PDB: 

Jmol
Position
10q26.3
AA seq 290 aa AA seqDB search
MAALRVLLSCVRGPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNA
LCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHW
DHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMA
KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccgccctgcgtgtcctgctgtcctgcgtccgcggcccgctgaggcccccggttcgc
tgtcccgcctggcgtcccttcgcctcgggtgctaactttgagtacatcatcgcagaaaaa
agagggaagaataacaccgtggggttgatccaactgaaccgccccaaggccctcaatgca
ctttgcgatggcctgattgacgagctcaaccaggccctgaagaccttcgaggaggacccg
gccgtgggggccattgtcctcaccggcggggataaggcctttgcagctggagctgatatc
aaggaaatgcagaacctgagtttccaggactgttactccagcaagttcttgaagcactgg
gaccacctcacccaggtcaagaagccagtcatcgctgctgtcaatggctatgcctttggc
gggggctgtgagcttgccatgatgtgtgatatcatctatgccggtgagaaggcccagttt
gcacagccggagatcttaataggaaccatcccaggtgcgggcggcacccagagactcacc
cgtgctgttgggaagtcgctggcgatggagatggtcctcactggtgaccggatctcagcc
caggacgccaagcaagcaggtcttgtcagcaagatttgtcctgttgagacactggtggaa
gaagccatccagtgtgcagaaaaaattgccagcaattctaaaattgtagtagcgatggcc
aaagaatcagtgaatgcagcttttgaaatgacattaacagaaggaagtaagttggagaag
aaactcttttattcaacctttgccactgatgaccggaaagaagggatgaccgcgtttgtg
gaaaagagaaaggccaacttcaaagaccagtga

DBGET integrated database retrieval system