KEGG   Homo sapiens (human): 1892Help
Entry
1892              CDS       T01001                                 

Gene name
ECHS1, SCEH
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; Fatty acid metabolism [PATH:hsa01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hsa00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hsa00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:hsa00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hsa00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hsa00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hsa00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:hsa00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q26.2-q26.3
AA seq 290 aa AA seqDB search
MAALRVLLSCVRGPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNA
LCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHW
DHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMA
KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccgccctgcgtgtcctgctgtcctgcgtccgcggcccgctgaggcccccggttcgc
tgtcccgcctggcgtcccttcgcctcgggtgctaactttgagtacatcatcgcagaaaaa
agagggaagaataacaccgtggggttgatccaactgaaccgccccaaggccctcaatgca
ctttgcgatggcctgattgacgagctcaaccaggccctgaagaccttcgaggaggacccg
gccgtgggggccattgtcctcaccggcggggataaggcctttgcagctggagctgatatc
aaggaaatgcagaacctgagtttccaggactgttactccagcaagttcttgaagcactgg
gaccacctcacccaggtcaagaagccagtcatcgctgctgtcaatggctatgcctttggc
gggggctgtgagcttgccatgatgtgtgatatcatctatgccggtgagaaggcccagttt
gcacagccggagatcttaataggaaccatcccaggtgcgggcggcacccagagactcacc
cgtgctgttgggaagtcgctggcgatggagatggtcctcactggtgaccggatctcagcc
caggacgccaagcaagcaggtcttgtcagcaagatttgtcctgttgagacactggtggaa
gaagccatccagtgtgcagaaaaaattgccagcaattctaaaattgtagtagcgatggcc
aaagaatcagtgaatgcagcttttgaaatgacattaacagaaggaagtaagttggagaag
aaactcttttattcaacctttgccactgatgaccggaaagaagggatgaccgcgtttgtg
gaaaagagaaaggccaacttcaaagaccagtga

DBGET integrated database retrieval system