KEGG   Homo sapiens (human): 1906Help
Entry
1906              CDS       T01001                                 

Gene name
EDN1, ARCND3, ET1, HDLCQ7, PPET1, QME
Definition
endothelin 1
Orthology
K16366  
endothelin-1
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
TNF signaling pathway
Melanogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    1906 (EDN1)
   04066 HIF-1 signaling pathway
    1906 (EDN1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1906 (EDN1)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    1906 (EDN1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    1906 (EDN1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    1906 (EDN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p24.1
AA seq 211 aa AA seqDB search
MDYLLMIFSLLFVACQGAPETVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDK
ECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWN
FCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSET
MRNSVKSSFHDPKLKGKPSRERYVTHNRAHW
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggattatttgctcatgattttctctctgctgtttgtggcttgccaaggagctccagaa
acagtcttaggcgctgagctcagcgcggtgggtgagaacggcggggagaaacccactccc
agtccaccctggcggctccgccggtccaagcgctgctcctgctcgtccctgatggataaa
gagtgtgtctacttctgccacctggacatcatttgggtcaacactcccgagcacgttgtt
ccgtatggacttggaagccctaggtccaagagagccttggagaatttacttcccacaaag
gcaacagaccgtgaaaatagatgccaatgtgctagccaaaaagacaagaagtgctggaat
ttttgccaagcaggaaaagaactcagggctgaagacattatggagaaagactggaataat
cataagaaaggaaaagactgttccaagcttgggaaaaagtgtatttatcagcagttagtg
agaggaagaaaaatcagaagaagttcagaggaacacctaagacaaaccaggtcggagacc
atgagaaacagcgtcaaatcatcttttcatgatcccaagctgaaaggcaagccctccaga
gagcgttatgtgacccacaaccgagcacattggtga

DBGET integrated database retrieval system