KEGG   Homo sapiens (human): 1906Help
Entry
1906              CDS       T01001                                 

Gene name
EDN1, ARCND3, ET1, HDLCQ7, PPET1, QME
Definition
(RefSeq) endothelin 1
  KO
K16366  
endothelin-1
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
TNF signaling pathway
Melanogenesis
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    1906 (EDN1)
   04066 HIF-1 signaling pathway
    1906 (EDN1)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    1906 (EDN1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    1906 (EDN1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    1906 (EDN1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    1906 (EDN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p24.1
AA seq 212 aa AA seqDB search
MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCW
NFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSE
TMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggattatttgctcatgattttctctctgctgtttgtggcttgccaaggagctccagaa
acagcagtcttaggcgctgagctcagcgcggtgggtgagaacggcggggagaaacccact
cccagtccaccctggcggctccgccggtccaagcgctgctcctgctcgtccctgatggat
aaagagtgtgtctacttctgccacctggacatcatttgggtcaacactcccgagcacgtt
gttccgtatggacttggaagccctaggtccaagagagccttggagaatttacttcccaca
aaggcaacagaccgtgaaaatagatgccaatgtgctagccaaaaagacaagaagtgctgg
aatttttgccaagcaggaaaagaactcagggctgaagacattatggagaaagactggaat
aatcataagaaaggaaaagactgttccaagcttgggaaaaagtgtatttatcagcagtta
gtgagaggaagaaaaatcagaagaagttcagaggaacacctaagacaaaccaggtcggag
accatgagaaacagcgtcaaatcatcttttcatgatcccaagctgaaaggcaagccctcc
agagagcgttatgtgacccacaaccgagcacattggtga

DBGET integrated database retrieval system