KEGG   Homo sapiens (human): 1950Help
Entry
1950              CDS       T01001                                 

Gene name
EGF, HOMG4, URG
Definition
epidermal growth factor
Orthology
K04357  
epidermal growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
FoxO signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Hepatitis C
Pathways in cancer
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Non-small cell lung cancer
Disease
H00018  
Gastric cancer
H01210  
Hypomagnesemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    1950 (EGF)
   04015 Rap1 signaling pathway
    1950 (EGF)
   04010 MAPK signaling pathway
    1950 (EGF)
   04012 ErbB signaling pathway
    1950 (EGF)
   04066 HIF-1 signaling pathway
    1950 (EGF)
   04068 FoxO signaling pathway
    1950 (EGF)
   04151 PI3K-Akt signaling pathway
    1950 (EGF)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1950 (EGF)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1950 (EGF)
  Cell motility
   04810 Regulation of actin cytoskeleton
    1950 (EGF)
  Cell communication
   04510 Focal adhesion
    1950 (EGF)
   04540 Gap junction
    1950 (EGF)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1950 (EGF)
   05212 Pancreatic cancer
    1950 (EGF)
   05214 Glioma
    1950 (EGF)
   05218 Melanoma
    1950 (EGF)
   05219 Bladder cancer
    1950 (EGF)
   05215 Prostate cancer
    1950 (EGF)
   05213 Endometrial cancer
    1950 (EGF)
   05223 Non-small cell lung cancer
    1950 (EGF)
  Infectious diseases
   05160 Hepatitis C
    1950 (EGF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q25
AA seq 1166 aa AA seqDB search
MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYEQLVVDAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHILLSALKYPANVAVDPVERFIFWSSEVAG
SLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLICSCDYDGGSVHI
SKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDMVRINLHSSFVPLGELKVVHP
LAQPKAEDDTWEPEQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCVPLSPVSWECDCFPGYDLQLDEKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVR
LQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKKRLGTAWCSCREGFMKASDGKTC
LALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC
SMYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCS
EGYQGDGIHCLDSTPPPHLREDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYAC
NCVVGYIGERCQYRDLKWWELRHAGHGQQQKVIVVAVCVVVLVMLLLLSLWGAHYYRTQK
LLSKNPKNPYEESSRDVRSRRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQA
ADGSMQPTSWRQEPQLCGMGTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEK
PHSLLSANPLWQQRALDPPHQMELTQ
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcactcttatcattctgttgccagtagtttcaaaatttagttttgttagtctc
tcagcaccgcagcactggagctgtcctgaaggtactctcgcaggaaatgggaattctact
tgtgtgggtcctgcacccttcttaattttctcccatggaaatagtatctttaggattgac
acagaaggaaccaattatgagcaattggtggtggatgctggtgtctcagtgatcatggat
tttcattataatgagaaaagaatctattgggtggatttagaaagacaacttttgcaaaga
gtttttctgaatgggtcaaggcaagagagagtatgtaatatagagaaaaatgtttctgga
atggcaataaattggataaatgaagaagttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaataattcccacattcttttaagtgctttaaaatatcct
gcaaatgtagcagttgatccagtagaaaggtttatattttggtcttcagaggtggctgga
agcctttatagagcagatctcgatggtgtgggagtgaaggctctgttggagacatcagag
aaaataacagctgtgtcattggatgtgcttgataagcggctgttttggattcagtacaac
agagaaggaagcaattctcttatttgctcctgtgattatgatggaggttctgtccacatt
agtaaacatccaacacagcataatttgtttgcaatgtccctttttggtgaccgtatcttc
tattcaacatggaaaatgaagacaatttggatagccaacaaacacactggaaaggacatg
gttagaattaacctccattcatcatttgtaccacttggtgaactgaaagtagtgcatcca
cttgcacaacccaaggcagaagatgacacttgggagcctgagcagaaactttgcaaattg
aggaaaggaaactgcagcagcactgtgtgtgggcaagacctccagtcacacttgtgcatg
tgtgcagagggatacgccctaagtcgagaccggaagtactgtgaagatgttaatgaatgt
gctttttggaatcatggctgtactcttgggtgtaaaaacacccctggatcctattactgc
acgtgccctgtaggatttgttctgcttcctgatgggaaacgatgtcatcaacttgtttcc
tgtccacgcaatgtgtctgaatgcagccatgactgtgttctgacatcagaaggtccctta
tgtttctgtcctgaaggctcagtgcttgagagagatgggaaaacatgtagcggttgttcc
tcacccgataatggtggatgtagccagctctgcgttcctcttagcccagtatcctgggaa
tgtgattgctttcctgggtatgacctacaactggatgaaaaaagctgtgcagcttcagga
ccacaaccatttttgctgtttgccaattctcaagatattcgacacatgcattttgatgga
acagactatggaactctgctcagccagcagatgggaatggtttatgccctagatcatgac
cctgtggaaaataagatatactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaggaaggagtagatgtgccagaaggtctt
gctgtggactggattggccgtagattctattggacagacagagggaaatctctgattgga
aggagtgatttaaatgggaaacgttccaaaataatcactaaggagaacatctctcaacca
cgaggaattgctgttcatccaatggccaagagattattctggactgatacagggattaat
ccacgaattgaaagttcttccctccaaggccttggccgtctggttatagccagctctgat
ctaatctggcccagtggaataacgattgacttcttaactgacaagttgtactggtgcgat
gccaagcagtctgtgattgaaatggccaatctggatggttcaaaacgccgaagacttacc
cagaatgatgtaggtcacccatttgctgtagcagtgtttgaggattatgtgtggttctca
gattgggctatgccatcagtaatgagagtaaacaagaggactggcaaagatagagtacgt
ctccaaggcagcatgctgaagccctcatcactggttgtggttcatccattggcaaaacca
ggagcagatccctgcttatatcaaaacggaggctgtgaacatatttgcaaaaagaggctt
ggaactgcttggtgttcgtgtcgtgaaggttttatgaaagcctcagatgggaaaacgtgt
ctggctctggatggtcatcagctgttggcaggtggtgaagttgatctaaagaaccaagta
acaccattggacatcttgtccaagactagagtgtcagaagataacattacagaatctcaa
cacatgctagtggctgaaatcatggtgtcagatcaagatgactgtgctcctgtgggatgc
agcatgtatgctcggtgtatttcagagggagaggatgccacatgtcagtgtttgaaagga
tttgctggggatggaaaactatgttctgatatagatgaatgtgagatgggtgtcccagtg
tgcccccctgcctcctccaagtgcatcaacaccgaaggtggttatgtctgccggtgctca
gaaggctaccaaggagatgggattcactgtcttgactctactccaccccctcacctcagg
gaagatgaccaccactattccgtaagaaatagtgactctgaatgtcccctgtcccacgat
gggtactgcctccatgatggtgtgtgcatgtatattgaagcattggacaagtatgcatgc
aactgtgttgttggctacatcggggagcgatgtcagtaccgagacctgaagtggtgggaa
ctgcgccacgctggccacgggcagcagcagaaggtcatcgtggtggctgtctgcgtggtg
gtgcttgtcatgctgctcctcctgagcctgtggggggcccactactacaggactcagaag
ctgctatcgaaaaacccaaagaatccttatgaggagtcgagcagagatgtgaggagtcgc
aggcctgctgacactgaggatgggatgtcctcttgccctcaaccttggtttgtggttata
aaagaacaccaagacctcaagaatgggggtcaaccagtggctggtgaggatggccaggca
gcagatgggtcaatgcaaccaacttcatggaggcaggagccccagttatgtggaatgggc
acagagcaaggctgctggattccagtatccagtgataagggctcctgtccccaggtaatg
gagcgaagctttcatatgccctcctatgggacacagacccttgaagggggtgtcgagaag
ccccattctctcctatcagctaacccattatggcaacaaagggccctggacccaccacac
caaatggagctgactcagtga

DBGET integrated database retrieval system