KEGG   Homo sapiens (human): 196Help
Entry
196               CDS       T01001                                 

Gene name
AHR, bHLHe76
Definition
(RefSeq) aryl hydrocarbon receptor
  KO
K09093  
aryl hydrocarbon receptor
Organism
hsa  Homo sapiens (human)
Pathway
Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    196 (AHR)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    196 (AHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P35869(Tchem)
UniProt: 
Position
7p21.1
AA seq 848 aa AA seqDB search
MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQ
ALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNP
SQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQ
GKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC
DAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRW
TWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF
PAIMDPLPLRTKNGTSGKDSATTSTLSKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAP
FENNFFNESMNECRNWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLY
SIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQ
QQQSLALNSSCMVQEHLHLEQQQQHHQKQVVVEPQQQLCQKMKHMQVNGMFENWNSNQFV
PFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNFISCNQPVLPQHSKCTELDYP
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQH
THVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFP
DLTSSGFL
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcagcagcgccaacatcacctacgccagtcgcaagcggcggaagccggtgcag
aaaacagtaaagccaatcccagctgaaggaatcaagtcaaatccttccaagcggcataga
gaccgacttaatacagagttggaccgtttggctagcctgctgcctttcccacaagatgtt
attaataagttggacaaactttcagttcttaggctcagcgtcagttacctgagagccaag
agcttctttgatgttgcattaaaatcctcccctactgaaagaaacggaggccaggataac
tgtagagcagcaaatttcagagaaggcctgaacttacaagaaggagaattcttattacag
gctctgaatggctttgtattagttgtcactacagatgctttggtcttttatgcttcttct
actatacaagattatctagggtttcagcagtctgatgtcatacatcagagtgtatatgaa
cttatccataccgaagaccgagctgaatttcagcgtcagctacactgggcattaaatcct
tctcagtgtacagagtctggacaaggaattgaagaagccactggtctcccccagacagta
gtctgttataacccagaccagattcctccagaaaactctcctttaatggagaggtgcttc
atatgtcgtctaaggtgtctgctggataattcatctggttttctggcaatgaatttccaa
gggaagttaaagtatcttcatggacagaaaaagaaagggaaagatggatcaatacttcca
cctcagttggctttgtttgcgatagctactccacttcagccaccatccatacttgaaatc
cggaccaaaaattttatctttagaaccaaacacaaactagacttcacacctattggttgt
gatgccaaaggaagaattgttttaggatatactgaagcagagctgtgcacgagaggctca
ggttatcagtttattcatgcagctgatatgctttattgtgccgagtcccatatccgaatg
attaagactggagaaagtggcatgatagttttccggcttcttacaaaaaacaaccgatgg
acttgggtccagtctaatgcacgcctgctttataaaaatggaagaccagattatatcatt
gtaactcagagaccactaacagatgaggaaggaacagagcatttacgaaaacgaaatacg
aagttgccttttatgtttaccactggagaagctgtgttgtatgaggcaaccaaccctttt
cctgccataatggatcccttaccactaaggactaaaaatggcactagtggaaaagactct
gctaccacatccactctaagcaaggactctctcaatcctagttccctcctggctgccatg
atgcaacaagatgagtctatttatctctatcctgcttcaagtacttcaagtactgcacct
tttgaaaacaactttttcaacgaatctatgaatgaatgcagaaattggcaagataatact
gcaccgatgggaaatgatactatcctgaaacatgagcaaattgaccagcctcaggatgtg
aactcatttgctggaggtcacccagggctctttcaagatagtaaaaacagtgacttgtac
agcataatgaaaaacctaggcattgattttgaagacatcagacacatgcagaatgaaaaa
tttttcagaaatgatttttctggtgaggttgacttcagagacattgacttaacggatgaa
atcctgacgtatgtccaagattctttaagtaagtctcccttcataccttcagattatcaa
cagcaacagtccttggctctgaactcaagctgtatggtacaggaacacctacatctagaa
cagcaacagcaacatcaccaaaagcaagtagtagtggagccacagcaacagctgtgtcag
aagatgaagcacatgcaagttaatggcatgtttgaaaattggaactctaaccaattcgtg
cctttcaattgtccacagcaagacccacaacaatataatgtctttacagacttacatggg
atcagtcaagagttcccctacaaatctgaaatggattctatgccttatacacagaacttt
atttcctgtaatcagcctgtattaccacaacattccaaatgtacagagctggactaccct
atggggagttttgaaccatccccataccccactacttctagtttagaagattttgtcact
tgtttacaacttcctgaaaaccaaaagcatggattaaatccacagtcagccataataact
cctcagacatgttatgctggggccgtgtcgatgtatcagtgccagccagaacctcagcac
acccacgtgggtcagatgcagtacaatccagtactgccaggccaacaggcatttttaaac
aagtttcagaatggagttttaaatgaaacatatccagctgaattaaataacataaataac
actcagactaccacacatcttcagccacttcatcatccgtcagaagccagaccttttcct
gatttgacatccagtggattcctgtaa

DBGET integrated database retrieval system