KEGG   Homo sapiens (human): 196Help
Entry
196               CDS       T01001                                 

Gene name
AHR, bHLHe76
Definition
(RefSeq) aryl hydrocarbon receptor
  KO
K09093  
aryl hydrocarbon receptor
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    196 (AHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p15
AA seq 848 aa AA seqDB search
MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQ
ALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNP
SQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQ
GKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC
DAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRW
TWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF
PAIMDPLPLRTKNGTSGKDSATTSTLSKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAP
FENNFFNESMNECRNWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLY
SIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQ
QQQSLALNSSCMVQEHLHLEQQQQHHQKQVVVEPQQQLCQKMKHMQVNGMFENWNSNQFV
PFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNFISCNQPVLPQHSKCTELDYP
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQH
THVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFP
DLTSSGFL
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcagcagcgccaacatcacctacgccagtcgcaagcggcggaagccggtgcag
aaaacagtaaagccaatcccagctgaaggaatcaagtcaaatccttccaagcggcataga
gaccgacttaatacagagttggaccgtttggctagcctgctgcctttcccacaagatgtt
attaataagttggacaaactttcagttcttaggctcagcgtcagttacctgagagccaag
agcttctttgatgttgcattaaaatcctcccctactgaaagaaacggaggccaggataac
tgtagagcagcaaatttcagagaaggcctgaacttacaagaaggagaattcttattacag
gctctgaatggctttgtattagttgtcactacagatgctttggtcttttatgcttcttct
actatacaagattatctagggtttcagcagtctgatgtcatacatcagagtgtatatgaa
cttatccataccgaagaccgagctgaatttcagcgtcagctacactgggcattaaatcct
tctcagtgtacagagtctggacaaggaattgaagaagccactggtctcccccagacagta
gtctgttataacccagaccagattcctccagaaaactctcctttaatggagaggtgcttc
atatgtcgtctaaggtgtctgctggataattcatctggttttctggcaatgaatttccaa
gggaagttaaagtatcttcatggacagaaaaagaaagggaaagatggatcaatacttcca
cctcagttggctttgtttgcgatagctactccacttcagccaccatccatacttgaaatc
cggaccaaaaattttatctttagaaccaaacacaaactagacttcacacctattggttgt
gatgccaaaggaagaattgttttaggatatactgaagcagagctgtgcacgagaggctca
ggttatcagtttattcatgcagctgatatgctttattgtgccgagtcccatatccgaatg
attaagactggagaaagtggcatgatagttttccggcttcttacaaaaaacaaccgatgg
acttgggtccagtctaatgcacgcctgctttataaaaatggaagaccagattatatcatt
gtaactcagagaccactaacagatgaggaaggaacagagcatttacgaaaacgaaatacg
aagttgccttttatgtttaccactggagaagctgtgttgtatgaggcaaccaaccctttt
cctgccataatggatcccttaccactaaggactaaaaatggcactagtggaaaagactct
gctaccacatccactctaagcaaggactctctcaatcctagttccctcctggctgccatg
atgcaacaagatgagtctatttatctctatcctgcttcaagtacttcaagtactgcacct
tttgaaaacaactttttcaacgaatctatgaatgaatgcagaaattggcaagataatact
gcaccgatgggaaatgatactatcctgaaacatgagcaaattgaccagcctcaggatgtg
aactcatttgctggaggtcacccagggctctttcaagatagtaaaaacagtgacttgtac
agcataatgaaaaacctaggcattgattttgaagacatcagacacatgcagaatgaaaaa
tttttcagaaatgatttttctggtgaggttgacttcagagacattgacttaacggatgaa
atcctgacgtatgtccaagattctttaagtaagtctcccttcataccttcagattatcaa
cagcaacagtccttggctctgaactcaagctgtatggtacaggaacacctacatctagaa
cagcaacagcaacatcaccaaaagcaagtagtagtggagccacagcaacagctgtgtcag
aagatgaagcacatgcaagttaatggcatgtttgaaaattggaactctaaccaattcgtg
cctttcaattgtccacagcaagacccacaacaatataatgtctttacagacttacatggg
atcagtcaagagttcccctacaaatctgaaatggattctatgccttatacacagaacttt
atttcctgtaatcagcctgtattaccacaacattccaaatgtacagagctggactaccct
atggggagttttgaaccatccccataccccactacttctagtttagaagattttgtcact
tgtttacaacttcctgaaaaccaaaagcatggattaaatccacagtcagccataataact
cctcagacatgttatgctggggccgtgtcgatgtatcagtgccagccagaacctcagcac
acccacgtgggtcagatgcagtacaatccagtactgccaggccaacaggcatttttaaac
aagtttcagaatggagttttaaatgaaacatatccagctgaattaaataacataaataac
actcagactaccacacatcttcagccacttcatcatccgtcagaagccagaccttttcct
gatttgacatccagtggattcctgtaa

DBGET integrated database retrieval system