KEGG   Homo sapiens (human): 1965Help
Entry
1965              CDS       T01001                                 

Gene name
EIF2S1, EIF-2, EIF-2A, EIF-2alpha, EIF2, EIF2A
Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit alpha
  KO
K03237  
translation initiation factor 2 subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Autophagy - animal
Protein processing in endoplasmic reticulum
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Measles
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    1965 (EIF2S1)
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1965 (EIF2S1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    1965 (EIF2S1)
  Cell growth and death
   04210 Apoptosis
    1965 (EIF2S1)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1965 (EIF2S1)
  Infectious diseases
   05162 Measles
    1965 (EIF2S1)
   05164 Influenza A
    1965 (EIF2S1)
   05160 Hepatitis C
    1965 (EIF2S1)
   05168 Herpes simplex infection
    1965 (EIF2S1)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-2
    1965 (EIF2S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P05198(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.3
AA seq 315 aa AA seqDB search
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccgggtctaagttgtagattttatcaacacaaatttcctgaggtggaagatgtagtg
atggtgaatgtcagatccattgctgaaatgggggcttatgtcagcttgctggaatacaac
aacattgaaggcatgattcttcttagtgaattatccagaaggcgtatccgttctatcaac
aaactcatccgaattggcaggaatgagtgtgtggttgtcattagggtggacaaagaaaaa
ggatatattgatttgtcaaaaagaagagtttctccagaggaagcaatcaaatgtgaagac
aaattcacaaaatccaaaactgtttatagcattcttcgtcatgttgctgaggtgttagaa
tacaccaaggatgagcagctggaaagcctattccagaggactgcctgggtctttgatgac
aagtacaagagacctggatatggtgcctatgatgcatttaagcatgcagtctcagaccca
tctattttggatagtttagatttgaatgaagatgaacgggaagtactcattaataatatt
aataggcgcttgaccccacaggctgtcaaaattcgagcagatattgaagtggcttgttat
ggttatgaaggcattgatgctgtaaaagaagccctaagagcaggtttgaattgttctaca
gaaaacatgcccattaagattaatctaatagctcctcctcggtatgtaatgactacgaca
accctggagagaacagaaggcctttctgtcctcagtcaagctatggctgttatcaaagag
aagattgaggaaaagaggggtgtgttcaatgttcaaatggagcccaaagtggtcacagat
acagatgagactgaacttgcgaggcagatggagaggcttgaaagagaaaatgccgaagtg
gatggagatgatgatgcagaagaaatggaagccaaagctgaagattaa

DBGET integrated database retrieval system