KEGG   Homo sapiens (human): 1965Help
Entry
1965              CDS       T01001                                 

Gene name
EIF2S1, EIF-2, EIF-2A, EIF-2alpha, EIF2, EIF2A
Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit alpha
  KO
K03237  
translation initiation factor 2 subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Protein processing in endoplasmic reticulum
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Measles
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    1965 (EIF2S1)
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1965 (EIF2S1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    1965 (EIF2S1)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1965 (EIF2S1)
  Infectious diseases
   05162 Measles
    1965 (EIF2S1)
   05164 Influenza A
    1965 (EIF2S1)
   05160 Hepatitis C
    1965 (EIF2S1)
   05168 Herpes simplex infection
    1965 (EIF2S1)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-2
    1965 (EIF2S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.3
AA seq 315 aa AA seqDB search
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccgggtctaagttgtagattttatcaacacaaatttcctgaggtggaagatgtagtg
atggtgaatgtcagatccattgctgaaatgggggcttatgtcagcttgctggaatacaac
aacattgaaggcatgattcttcttagtgaattatccagaaggcgtatccgttctatcaac
aaactcatccgaattggcaggaatgagtgtgtggttgtcattagggtggacaaagaaaaa
ggatatattgatttgtcaaaaagaagagtttctccagaggaagcaatcaaatgtgaagac
aaattcacaaaatccaaaactgtttatagcattcttcgtcatgttgctgaggtgttagaa
tacaccaaggatgagcagctggaaagcctattccagaggactgcctgggtctttgatgac
aagtacaagagacctggatatggtgcctatgatgcatttaagcatgcagtctcagaccca
tctattttggatagtttagatttgaatgaagatgaacgggaagtactcattaataatatt
aataggcgcttgaccccacaggctgtcaaaattcgagcagatattgaagtggcttgttat
ggttatgaaggcattgatgctgtaaaagaagccctaagagcaggtttgaattgttctaca
gaaaacatgcccattaagattaatctaatagctcctcctcggtatgtaatgactacgaca
accctggagagaacagaaggcctttctgtcctcagtcaagctatggctgttatcaaagag
aagattgaggaaaagaggggtgtgttcaatgttcaaatggagcccaaagtggtcacagat
acagatgagactgaacttgcgaggcagatggagaggcttgaaagagaaaatgccgaagtg
gatggagatgatgatgcagaagaaatggaagccaaagctgaagattaa

DBGET integrated database retrieval system