KEGG   Homo sapiens (human): 196527Help
Entry
196527            CDS       T01001                                 

Gene name
ANO6, BDPLT7, SCTS, TMEM16F
Definition
(RefSeq) anoctamin 6
  KO
K19500  
anoctamin-6
Organism
hsa  Homo sapiens (human)
Disease
H01162  
Scott syndrome
Brite
Ion channels [BR:hsa04040]
 Chloride channels
  Calcium activated chloride channel
   196527 (ANO6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q12
AA seq 910 aa AA seqDB search
MKKMSRNVLLQMEEEEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSL
FFNDGQRRIDFVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLDDK
LVFVKVHAPWEVLCTYAEIMHIKLPLKPNDLKNRSSAFGTLNWFTKVLSVDESIIKPEQE
FFTAPFEKNRMNDFYIVDRDAFFNPATRSRIVYFILSRVKYQVINNVSKFGINRLVNSGI
YKAAFPLHDCKFRRQSEDPSCPNERYLLYREWAHPRSIYKKQPLDLIRKYYGEKIGIYFA
WLGYYTQMLLLAAVVGVACFLYGYLNQDNCTWSKEVCHPDIGGKIIMCPQCDRLCPFWKL
NITCESSKKLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARP
EYEARCTHVVINEITQEEERIPFTAWGKCIRITLCASAVFFWILLIIASVIGIIVYRLSV
FIVFSAKLPKNINGTDPIQKYLTPQTATSITASIISFIIIMILNTIYEKVAIMITNFELP
RTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEECDPGGC
LLELTTQLTIIMGGKAIWNNIQEVLLPWIMNLIGRFHRVSGSEKITPRWEQDYHLQPMGK
LGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWKLTTQFRRLVPEKAQD
IGAWQPIMQGIAILAVVTNAMIIAFTSDMIPRLVYYWSFSVPPYGDHTSYTMEGYINNTL
SIFKVADFKNKSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV
MEHVIYSVKFFISYAIPDVSKRTKSKIQREKYLTQKLLHENHLKDMTKNMGVIAERMIEA
VDNNLRPKSE
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatgagcaggaatgttttgctacaaatggaggaggaggaggacgacgacgat
ggggatatcgtgttggaaaaccttggacagacaattgtccccgatttgggatcactggaa
agtcagcatgattttcgaaccccggagtttgaagaatttaatggaaaacctgactccctc
ttttttaatgatggccagcgaagaattgactttgttctagtatatgaggatgaaagcaga
aaagagaccaataaaaagggtacaaatgaaaaacaaaggaggaaaagacaagcatacgaa
tctaaccttatctgtcatggcctgcagttagaagcaacaagatcagtattggatgacaag
cttgtatttgtaaaagtacacgcaccatgggaggtgttatgtacgtatgctgagataatg
cacatcaaattgcctctgaaacccaatgatctgaaaaaccggtcctcagcctttggtaca
ctcaactggtttaccaaagtcctcagtgtagacgaaagcatcatcaagccagagcaagag
tttttcactgccccatttgagaagaaccggatgaatgatttttacatagttgatagagat
gctttcttcaatccagccaccagaagccgcattgtttacttcatcctctctcgggtcaag
tatcaagtgataaacaatgttagcaagtttgggatcaacagacttgtaaactctgggatc
tacaaggcagctttcccactccatgattgcaaattccgccgtcagtcagaggatcccagc
tgccctaatgaacggtaccttctgtacagagaatgggctcatcctcgaagcatatacaaa
aagcagcccttggatcttatcaggaaatactatggagagaagattggaatctactttgct
tggctgggctattacactcagatgcttctcctggccgcagttgtaggagtggcttgcttt
ctctatggatatcttaatcaagataactgtacatggagcaaagaagtttgtcatcctgat
attggtggcaagatcataatgtgtcctcagtgtgataggctttgtccattctggaaactc
aatattacttgcgagtcctcaaagaaattgtgcatcttcgacagttttggaaccctggtc
tttgcagtatttatgggagtatgggttaccttgtttttggagttttggaagcgacgccag
gcagaacttgagtatgaatgggatactgttgagttacagcaggaagaacaagcccgacca
gaatacgaagcacgatgtactcacgtagtgataaatgagattactcaggaagaagaacgc
attccctttactgcctggggaaaatgtatacggataaccctctgtgccagtgctgtcttt
ttctggatcctattgatcatcgcttcagttattgggatcattgtctataggctctcggtg
ttcattgtattttctgcaaaacttcccaagaacattaatggaacagacccaatccagaaa
tacctgactccacagacagccacgtccatcacggcctccatcatcagctttataattatc
atgattctgaacaccatatatgaaaaagtggcaattatgattactaacttcgaactccca
aggacccagactgattatgagaacagcctcaccatgaagatgttcttattccagtttgtc
aactactactcttcatgcttctacatagcattctttaagggcaaatttgtaggctatcca
ggagacccagtttattggttgggaaaatacagaaatgaagagtgtgacccaggtggctgt
cttcttgaactgacaactcagctgacaataatcatgggaggaaaagcaatctggaataac
atacaagaagtattattgccctggatcatgaatctaattgggcgatttcacagagtttct
ggatcagaaaagataaccccacgatgggaacaggactaccatctgcagcctatgggcaaa
ctgggattattttatgaatatcttgaaatgattattcagtttgggttcgtcaccttattt
gtggcctcttttccactggcccctctgttggctctcgtgaacaatatattggaaataaga
gtggacgcatggaaactgaccacccagtttagacgcctggtaccagagaaagcccaagac
attggagcatggcagcccatcatgcaaggaatagcaattctggctgtggtgaccaatgcc
atgatcatagctttcacgtcggacatgatcccccgcctagtgtactactggtccttctcc
gtccctccctacggggaccacacttcctacaccatggaagggtacatcaacaacactctc
tccatcttcaaagtcgcagacttcaaaaacaaaagcaagggaaacccgtactctgacctg
ggtaaccataccacatgcaggtatcgtgatttccgatacccacctggacacccccaggag
tataaacacaacatctactattggcatgtgattgcagccaagctggcttttatcattgtc
atggagcacgtcatctactctgtgaaatttttcatttcatatgcaattcccgatgtatca
aaacgcacaaagagcaagatccagagagaaaaatacctaacccaaaagcttcttcatgag
aatcacctcaaagatatgacgaaaaatatgggggtgatagctgagcggatgatagaagca
gtagataacaatttacggccaaaatcagaataa

DBGET integrated database retrieval system