KEGG   Homo sapiens (human): 196883Help
Entry
196883            CDS       T01001                                 

Gene name
ADCY4, AC4
Definition
adenylate cyclase 4 (EC:4.6.1.1)
Orthology
K08044  
adenylate cyclase 4 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
HTLV-I infection
Dilated cardiomyopathy
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    196883 (ADCY4)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    196883 (ADCY4)
   04020 Calcium signaling pathway
    196883 (ADCY4)
   04024 cAMP signaling pathway
    196883 (ADCY4)
   04022 cGMP - PKG signaling pathway
    196883 (ADCY4)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    196883 (ADCY4)
  Cellular commiunity
   04540 Gap junction
    196883 (ADCY4)
 Organismal Systems
  Immune system
   04611 Platelet activation
    196883 (ADCY4)
   04062 Chemokine signaling pathway
    196883 (ADCY4)
  Endocrine system
   04911 Insulin secretion
    196883 (ADCY4)
   04912 GnRH signaling pathway
    196883 (ADCY4)
   04913 Ovarian Steroidogenesis
    196883 (ADCY4)
   04915 Estrogen signaling pathway
    196883 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    196883 (ADCY4)
   04921 Oxytocin signaling pathway
    196883 (ADCY4)
   04918 Thyroid hormone synthesis
    196883 (ADCY4)
   04916 Melanogenesis
    196883 (ADCY4)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    196883 (ADCY4)
   04270 Vascular smooth muscle contraction
    196883 (ADCY4)
  Digestive system
   04970 Salivary secretion
    196883 (ADCY4)
   04971 Gastric acid secretion
    196883 (ADCY4)
   04972 Pancreatic secretion
    196883 (ADCY4)
   04976 Bile secretion
    196883 (ADCY4)
  Nervous system
   04724 Glutamatergic synapse
    196883 (ADCY4)
   04727 GABAergic synapse
    196883 (ADCY4)
   04725 Cholinergic synapse
    196883 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    196883 (ADCY4)
  Sensory system
   04742 Taste transduction
    196883 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    196883 (ADCY4)
  Environmental adaptation
   04713 Circadian entrainment
    196883 (ADCY4)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    196883 (ADCY4)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    196883 (ADCY4)
  Infectious diseases
   05166 HTLV-I infection
    196883 (ADCY4)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     196883 (ADCY4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q12
AA seq 1077 aa AA seqDB search
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTAYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTR
YLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRP
GLRIALGTATILLVFAMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPY
SMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccgccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctggggatcgtgctctgtgcg
ctcgcggcgctgctcgcagtggcctgggccagcggcagggagctgacctcagacccgagc
ttcctgaccactgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgggagcagcgactgcagcgctggacgcgtcccctgtccggcttggtatgggtcgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctattttctcttcgtcatcttcacggcgtatgccatgctgcccttgggcatgcgggac
gccgccgtcgcgggcctcgcctcctcactctcgcatctgctggtcctcgggctgtatctt
gggccacagccggactcacggcctgcactgctgccgcagttggcagcaaacgcagtgctg
ttcctgtgcgggaacgtggcaggagtgtaccacaaggcgctgatggagcgcgccctgcgg
gccacgttccgggaggcactcagctccctgcactcacgccggcggctggacaccgagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaag
gcagagatcatggcacggctgcaggcaggacaggggtcacggccagagagcactaacaat
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgcggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaagttcgaccagattgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctctgggctgccactctcactgccagaccatgccatcaac
tgcgtgcgcatgggcctggacatgtgccgggccatcaggaaactgcgggcagccactggc
gtggacatcaacatgcgtgtgggcgtgcactcaggcagcgtactgtgtggagtcatcggg
ctgcagaagtggcagtacgacgtttggtcacatgatgtcacactggctaaccacatggag
gcaggcggtgtaccagggcgagtgcacatcacaggggctaccctggccctgctggcaggg
gcttatgctgtggaggacgcaggcatggagcatcgggacccctaccttcgggagctaggg
gagcctacctatctggtcatcgatccacgggcagaggaggaggatgagaagggcactgca
ggaggcttgctgtcctcgcttgagggcctcaagatgcgtccatcactgctgatgacccgt
tacctggagtcctggggcgcagccaagccttttgcccacctgagccacggagacagccct
gtgtccacctccacccctctcccggagaagaccctggcttccttcagcacccagtggagc
ctggatcggagccgtaccccccggggactagatgatgaactggacaccggggatgccaag
ttcttccaggtcattgagcagctcaactcgcagaaacagtggaagcagtcgaaggacttc
aacccactgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
atccccgccttcaaatactatgaagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctagtgacaaacaggcccccagctctggccatcacgtatagcatcaccttc
ctcctcttcctcctcatcctttttgtctgcttctcagaggacctgatgaggtgtgtcctg
aaaggccccaagatgctgcactggctgcctgcactgtctggcctggtggccacacgacca
ggactgagaatagccttgggcaccgccaccatcctccttgtctttgccatggccattacc
agcctgttcttcttcccaacatcatcagactgccctttccaagctcccaatgtgtcctcc
atgatttccaacctctcctgggagctccctgggtctctgcctctcatcagtgtcccatac
tccatgcactgctgcacgctgggcttcctctcctgctccctctttctgcacatgagcttc
gagctgaagctgctgctgctcctgctgtggctggcggcatcctgctccctcttcctgcac
tcccatgcctggctgtcggaatgcctcatcgtccgcctctatctgggccccttggactcc
aggcccggagtgctgaaggagcccaaactgatgggtgctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcgccagaatgagtactactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagagggaggagacagagacgatggagaacctgactcggctg
ctcttggagaacgtgctccctgcacacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcctatgaatgcgtttgtgtcctcttcgcctcagtccca
gacttcaaggagttctactctgaatccaacatcaatcatgagggcctagagtgtctgagg
ctgctcaatgagataattgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaagatcaagaccatcggcagcacctacatggcagccacaggcttaaatgccacc
tctggacaggatgcacaacaggatgctgaacggagctgcagccaccttggcactatggtg
gaatttgccgtggccctggggtctaagctggacgtcatcaacaagcattcattcaacaac
ttccgcctgcgagtggggttgaaccatggacccgtagtagctggagttattggggcccag
aagccgcaatatgacatttggggcaacacagtgaacgtggccagccgcatggagagtaca
ggagtccttggcaaaatccaagtgactgaggagacagcatgggccctacagtccctgggc
tacacctgctacagccggggtgtcatcaaggtgaaaggcaaagggcagctctgcacctac
ttcctgaacacagacttgacacgaactggacctccttcagctaccctaggctga

DBGET integrated database retrieval system